BLASTX nr result
ID: Mentha23_contig00031019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00031019 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30017.1| hypothetical protein MIMGU_mgv1a010177mg [Mimulus... 56 6e-06 >gb|EYU30017.1| hypothetical protein MIMGU_mgv1a010177mg [Mimulus guttatus] Length = 320 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/55 (60%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = -2 Query: 356 GPYAYFRALEESHA--TDEPSNGISMEGVQSAATNGNGADQNLDSSFDAMESGRR 198 GPYAYFRALEES + P+N I M+GV N QN DSSFDAMESGRR Sbjct: 273 GPYAYFRALEESRSILVPPPNNEIGMQGV-------NLNHQNQDSSFDAMESGRR 320