BLASTX nr result
ID: Mentha23_contig00029845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00029845 (420 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007144608.1| hypothetical protein PHAVU_007G169700g [Phas... 69 9e-10 ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Popu... 68 1e-09 ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659... 68 2e-09 ref|XP_007200898.1| hypothetical protein PRUPE_ppb017528mg [Prun... 65 1e-08 ref|XP_007162403.1| hypothetical protein PHAVU_001G149100g [Phas... 63 5e-08 >ref|XP_007144608.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] gi|561017798|gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] Length = 45 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 155 SVFPTRSLKQRSVQRCSKQMREQKARLYIVWRCAVLLLCWHE 280 SVF R K RS +RCSKQ+R+Q+ RLYI+WRC VLLLCWHE Sbjct: 4 SVFSVRGSKIRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] gi|222861166|gb|EEE98708.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] Length = 64 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = +2 Query: 128 QTQRKMASYSVFPTRSLKQRSVQRCSKQMREQKARLYIVWRCAVLLLCWHE 280 +T+ +MA+ RS+K RS QRCSKQ+REQ+ RLYI+WRC V+LLCWH+ Sbjct: 15 ETKIQMAA-DALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659834 [Glycine max] Length = 45 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 155 SVFPTRSLKQRSVQRCSKQMREQKARLYIVWRCAVLLLCWHE 280 +VF R K RS +RCSKQ+R+Q+ RLYI+WRC VLLLCWHE Sbjct: 4 NVFSVRGSKVRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_007200898.1| hypothetical protein PRUPE_ppb017528mg [Prunus persica] gi|462396298|gb|EMJ02097.1| hypothetical protein PRUPE_ppb017528mg [Prunus persica] Length = 67 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/47 (63%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 143 MASYSVFPTRS-LKQRSVQRCSKQMREQKARLYIVWRCAVLLLCWHE 280 MA+ ++ TRS LK R RCSK +REQ+ARLYIVWRC+V+LLCWH+ Sbjct: 21 MAAMAIPTTRSSLKLRPWTRCSKHIREQRARLYIVWRCSVMLLCWHD 67 >ref|XP_007162403.1| hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] gi|561035867|gb|ESW34397.1| hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] Length = 70 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/61 (52%), Positives = 39/61 (63%) Frame = +2 Query: 98 HNLHTSNFFFQTQRKMASYSVFPTRSLKQRSVQRCSKQMREQKARLYIVWRCAVLLLCWH 277 HNL T NF T A +S R+ K R RCSK +R+Q+ RLYI+WRC VLLLCWH Sbjct: 13 HNL-TLNFTMTTATTTAMFSSL--RASKLRPWGRCSKYIRQQRTRLYIIWRCTVLLLCWH 69 Query: 278 E 280 + Sbjct: 70 D 70