BLASTX nr result
ID: Mentha23_contig00029797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00029797 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23320.1| hypothetical protein MIMGU_mgv1a003200mg [Mimulus... 60 3e-07 >gb|EYU23320.1| hypothetical protein MIMGU_mgv1a003200mg [Mimulus guttatus] Length = 600 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/69 (47%), Positives = 38/69 (55%), Gaps = 5/69 (7%) Frame = -2 Query: 217 MKKLRNAEPTKLNPKSPRIRANXXXXXXXXXXXXXXDLSF-----PLFFSFWCAIVLFHA 53 MKK RNAEP KLN + +IRAN F PLFFSFWC + F++ Sbjct: 1 MKKSRNAEPKKLNDELGKIRANNHTNKLDFDDKIDRKSLFNLSAVPLFFSFWCFAIFFNS 60 Query: 52 KFGITRGNE 26 KFGIT GNE Sbjct: 61 KFGITDGNE 69