BLASTX nr result
ID: Mentha23_contig00029549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00029549 (702 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32107.1| hypothetical protein MIMGU_mgv1a010495mg [Mimulus... 57 6e-06 >gb|EYU32107.1| hypothetical protein MIMGU_mgv1a010495mg [Mimulus guttatus] Length = 310 Score = 57.0 bits (136), Expect = 6e-06 Identities = 28/49 (57%), Positives = 32/49 (65%) Frame = +1 Query: 208 MDQREAITLPGSASYYLHQGNADSVMGLQXXXXXXXXXXXXLHFQSNAG 354 MDQREA++L GSASYY+H G A+SV GLQ LHFQSN G Sbjct: 1 MDQREAMSLTGSASYYMHPGTAESVTGLQSSPNMSPLSNAALHFQSNIG 49