BLASTX nr result
ID: Mentha23_contig00029543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00029543 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19288.1| hypothetical protein MIMGU_mgv1a022146mg, partial... 66 6e-09 >gb|EYU19288.1| hypothetical protein MIMGU_mgv1a022146mg, partial [Mimulus guttatus] Length = 687 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/47 (72%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -2 Query: 412 VLQQQLKTGNLPEVAVFDGNQNIPPKSNL-PTVQEPILGNLLFRVPQ 275 VLQQQLK+GNLPEV VF N+NI KSN TVQEPILGNLLF P+ Sbjct: 641 VLQQQLKSGNLPEVGVFPNNENISVKSNFGATVQEPILGNLLFNAPK 687