BLASTX nr result
ID: Mentha23_contig00027953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00027953 (514 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007042389.1| Cyclin-dependent kinase inhibitor family pro... 63 4e-08 ref|XP_004294829.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 1e-07 ref|XP_004294828.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 1e-07 ref|XP_007155934.1| hypothetical protein PHAVU_003G244700g [Phas... 59 7e-07 gb|EYU37694.1| hypothetical protein MIMGU_mgv1a014142mg [Mimulus... 58 1e-06 gb|AET07180.1| ICK [Rosa hybrid cultivar] 58 1e-06 ref|XP_002518785.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 gb|EXC17359.1| Cyclin-dependent kinase inhibitor 7 [Morus notabi... 57 3e-06 ref|XP_004136985.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 3e-06 ref|XP_006346465.1| PREDICTED: cyclin-dependent kinase inhibitor... 56 5e-06 ref|XP_004230818.1| PREDICTED: cyclin-dependent kinase inhibitor... 56 5e-06 ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor... 56 5e-06 emb|CBI21439.3| unnamed protein product [Vitis vinifera] 56 5e-06 ref|XP_002282040.2| PREDICTED: cyclin-dependent kinase inhibitor... 56 6e-06 emb|CBI32432.3| unnamed protein product [Vitis vinifera] 56 6e-06 gb|EXB55911.1| Cyclin-dependent kinase inhibitor 7 [Morus notabi... 55 8e-06 emb|CAC41621.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis... 55 8e-06 ref|XP_007156548.1| hypothetical protein PHAVU_003G295400g [Phas... 55 8e-06 ref|NP_175385.1| cyclin-dependent kinase inhibitor 7 [Arabidopsi... 55 8e-06 ref|XP_003529390.1| PREDICTED: cyclin-dependent kinase inhibitor... 55 8e-06 >ref|XP_007042389.1| Cyclin-dependent kinase inhibitor family protein, putative [Theobroma cacao] gi|508706324|gb|EOX98220.1| Cyclin-dependent kinase inhibitor family protein, putative [Theobroma cacao] Length = 210 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 YE KRFAEKYNYDIVKDVPL+G+Y WVRL+P Sbjct: 180 YEQKRFAEKYNYDIVKDVPLDGRYQWVRLMP 210 >ref|XP_004294829.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like isoform 2 [Fragaria vesca subsp. vesca] Length = 176 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 YE KRFAEKYN+DIVK+ PLEG+YHWVRL P Sbjct: 146 YEQKRFAEKYNFDIVKEAPLEGRYHWVRLKP 176 >ref|XP_004294828.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like isoform 1 [Fragaria vesca subsp. vesca] Length = 177 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 YE KRFAEKYN+DIVK+ PLEG+YHWVRL P Sbjct: 147 YEQKRFAEKYNFDIVKEAPLEGRYHWVRLKP 177 >ref|XP_007155934.1| hypothetical protein PHAVU_003G244700g [Phaseolus vulgaris] gi|561029288|gb|ESW27928.1| hypothetical protein PHAVU_003G244700g [Phaseolus vulgaris] Length = 191 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 506 HKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 HKRF+EKYNYDIVKDVPLEG+Y WV+L P Sbjct: 163 HKRFSEKYNYDIVKDVPLEGRYEWVKLKP 191 >gb|EYU37694.1| hypothetical protein MIMGU_mgv1a014142mg [Mimulus guttatus] Length = 199 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 YE KRFAEKYN+DIV DVPLEG Y WVRL P Sbjct: 169 YEQKRFAEKYNFDIVNDVPLEGTYQWVRLQP 199 >gb|AET07180.1| ICK [Rosa hybrid cultivar] Length = 180 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 YE KRFAEKYN+DIVK+ PLEG+Y WVRL P Sbjct: 150 YEQKRFAEKYNFDIVKEAPLEGRYRWVRLKP 180 >ref|XP_002518785.1| conserved hypothetical protein [Ricinus communis] gi|223542166|gb|EEF43710.1| conserved hypothetical protein [Ricinus communis] Length = 202 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 509 EHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 E KRFA+KYNYDIVKD+PLEG+Y WVRL P Sbjct: 173 EQKRFADKYNYDIVKDLPLEGRYQWVRLKP 202 >gb|EXC17359.1| Cyclin-dependent kinase inhibitor 7 [Morus notabilis] Length = 199 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 509 EHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 E KRFAEKYNYDIV D+PLEG+YHWV L P Sbjct: 170 EQKRFAEKYNYDIVNDMPLEGRYHWVCLKP 199 >ref|XP_004136985.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Cucumis sativus] Length = 208 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 YE KRF+EKYN+DI+ DVPLEG+Y W+RL P Sbjct: 178 YEQKRFSEKYNFDIIMDVPLEGRYQWIRLKP 208 >ref|XP_006346465.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Solanum tuberosum] Length = 199 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 509 EHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 E KRFAEKYNYDIVKD PLEG+Y WV L P Sbjct: 170 EQKRFAEKYNYDIVKDAPLEGRYQWVSLKP 199 >ref|XP_004230818.1| PREDICTED: cyclin-dependent kinase inhibitor 6-like [Solanum lycopersicum] Length = 222 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 509 EHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 E KRFAEKYNYDIVKD PLEG+Y WV L P Sbjct: 188 EQKRFAEKYNYDIVKDAPLEGRYQWVSLKP 217 >ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Vitis vinifera] Length = 227 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 503 KRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 KRF+EKYNYDIVKDVP+EG+Y WVRL P Sbjct: 200 KRFSEKYNYDIVKDVPMEGRYEWVRLKP 227 >emb|CBI21439.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 503 KRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 KRF+EKYNYDIVKDVP+EG+Y WVRL P Sbjct: 185 KRFSEKYNYDIVKDVPMEGRYEWVRLKP 212 >ref|XP_002282040.2| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Vitis vinifera] Length = 203 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRL 426 Y+ +RFAEKYNYDIVKD P+EG+Y WVRL Sbjct: 173 YQQQRFAEKYNYDIVKDAPMEGRYQWVRL 201 >emb|CBI32432.3| unnamed protein product [Vitis vinifera] Length = 234 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRL 426 Y+ +RFAEKYNYDIVKD P+EG+Y WVRL Sbjct: 204 YQQQRFAEKYNYDIVKDAPMEGRYQWVRL 232 >gb|EXB55911.1| Cyclin-dependent kinase inhibitor 7 [Morus notabilis] Length = 251 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 503 KRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 KRFAEKYNYDIVKD PLEG+Y W+RL P Sbjct: 224 KRFAEKYNYDIVKDTPLEGRYEWLRLKP 251 >emb|CAC41621.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis thaliana] Length = 195 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 YE KRF EKYNYDIV D PLEG+Y WV L P Sbjct: 165 YEQKRFTEKYNYDIVNDTPLEGRYQWVSLKP 195 >ref|XP_007156548.1| hypothetical protein PHAVU_003G295400g [Phaseolus vulgaris] gi|561029902|gb|ESW28542.1| hypothetical protein PHAVU_003G295400g [Phaseolus vulgaris] Length = 191 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRL 426 YE KRF EKYN+DIV+D+PLEG+Y WVRL Sbjct: 162 YEQKRFVEKYNFDIVRDMPLEGRYQWVRL 190 >ref|NP_175385.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis thaliana] gi|152032531|sp|Q94CL9.2|KRP7_ARATH RecName: Full=Cyclin-dependent kinase inhibitor 7; AltName: Full=Inhibitor/interactor of CDK protein 5; AltName: Full=KIP-related protein 7 gi|10120423|gb|AAG13048.1|AC011807_7 Hypothetical protein [Arabidopsis thaliana] gi|332194329|gb|AEE32450.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis thaliana] Length = 195 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRLLP 420 YE KRF EKYNYDIV D PLEG+Y WV L P Sbjct: 165 YEQKRFTEKYNYDIVNDTPLEGRYQWVSLKP 195 >ref|XP_003529390.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Glycine max] Length = 187 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 512 YEHKRFAEKYNYDIVKDVPLEGKYHWVRL 426 YE KRF EKYN+DIV+D+PLEG+Y WVRL Sbjct: 158 YEQKRFTEKYNFDIVRDLPLEGRYQWVRL 186