BLASTX nr result
ID: Mentha23_contig00027937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00027937 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22925.1| hypothetical protein MIMGU_mgv1a022556mg [Mimulus... 58 1e-06 >gb|EYU22925.1| hypothetical protein MIMGU_mgv1a022556mg [Mimulus guttatus] Length = 185 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/84 (39%), Positives = 46/84 (54%) Frame = -2 Query: 401 DKLIGEVSLRVKSLFDYGLTCANTLTFDVNGTTNGKLNILYSFGNVFLAQKQKHLNLQQP 222 DK +G V + +KSLFD GL+ ++ V GT GKLNI Y+F VF K +L + Sbjct: 101 DKFVGHVDVPLKSLFDAGLSTEKIFSYTVAGTPYGKLNITYTFSEVFCVTK---ASLLKA 157 Query: 221 LVQGGLVAVGGMIVKGVWELATGD 150 +G +A +V G W + TGD Sbjct: 158 AARGAGIAA---LVHGAWFMLTGD 178