BLASTX nr result
ID: Mentha23_contig00027783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00027783 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22307.1| hypothetical protein MIMGU_mgv1a007165mg [Mimulus... 65 1e-08 ref|XP_007037075.1| Endosomal targeting BRO1-like domain-contain... 64 3e-08 ref|XP_007037076.1| Endosomal targeting BRO1-like domain-contain... 63 5e-08 ref|XP_007037074.1| Endosomal targeting BRO1-like domain-contain... 63 5e-08 gb|EXB87536.1| Eukaryotic translation initiation factor 6-2 [Mor... 62 6e-08 ref|XP_004495492.1| PREDICTED: uncharacterized protein LOC101515... 62 6e-08 ref|XP_004299454.1| PREDICTED: uncharacterized protein LOC101309... 62 6e-08 ref|XP_007152520.1| hypothetical protein PHAVU_004G137200g [Phas... 62 1e-07 ref|XP_003534075.1| PREDICTED: uncharacterized protein LOC100820... 62 1e-07 ref|XP_006351540.1| PREDICTED: uncharacterized protein LOC102579... 61 2e-07 ref|XP_006589244.1| PREDICTED: uncharacterized protein LOC100813... 60 2e-07 ref|XP_006478139.1| PREDICTED: uncharacterized protein LOC102623... 60 2e-07 ref|XP_006441473.1| hypothetical protein CICLE_v10021034mg [Citr... 60 2e-07 ref|XP_003556420.1| PREDICTED: uncharacterized protein LOC100781... 60 2e-07 ref|XP_006589242.1| PREDICTED: uncharacterized protein LOC100813... 60 2e-07 ref|XP_004512801.1| PREDICTED: uncharacterized protein LOC101512... 60 3e-07 ref|XP_007209163.1| hypothetical protein PRUPE_ppa006106mg [Prun... 60 3e-07 ref|XP_004234329.1| PREDICTED: uncharacterized protein LOC101254... 60 4e-07 ref|XP_002305035.1| hypothetical protein POPTR_0004s06600g [Popu... 60 4e-07 gb|AFK48379.1| unknown [Medicago truncatula] 59 5e-07 >gb|EYU22307.1| hypothetical protein MIMGU_mgv1a007165mg [Mimulus guttatus] Length = 416 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC VST K+SGGNRRRP NIGDV+VFVPGLRIP Sbjct: 1 MGCFVSTPKDSGGNRRRPTNIGDVSVFVPGLRIP 34 >ref|XP_007037075.1| Endosomal targeting BRO1-like domain-containing protein isoform 2 [Theobroma cacao] gi|508774320|gb|EOY21576.1| Endosomal targeting BRO1-like domain-containing protein isoform 2 [Theobroma cacao] Length = 441 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +3 Query: 300 EMGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 +MGC+VST K+SGGNRRRP NIG+++V+VPGLRIP Sbjct: 18 DMGCLVSTPKDSGGNRRRPGNIGEISVYVPGLRIP 52 >ref|XP_007037076.1| Endosomal targeting BRO1-like domain-containing protein isoform 3, partial [Theobroma cacao] gi|508774321|gb|EOY21577.1| Endosomal targeting BRO1-like domain-containing protein isoform 3, partial [Theobroma cacao] Length = 350 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC+VST K+SGGNRRRP NIG+++V+VPGLRIP Sbjct: 1 MGCLVSTPKDSGGNRRRPGNIGEISVYVPGLRIP 34 >ref|XP_007037074.1| Endosomal targeting BRO1-like domain-containing protein isoform 1 [Theobroma cacao] gi|508774319|gb|EOY21575.1| Endosomal targeting BRO1-like domain-containing protein isoform 1 [Theobroma cacao] Length = 468 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC+VST K+SGGNRRRP NIG+++V+VPGLRIP Sbjct: 1 MGCLVSTPKDSGGNRRRPGNIGEISVYVPGLRIP 34 >gb|EXB87536.1| Eukaryotic translation initiation factor 6-2 [Morus notabilis] Length = 414 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGCI ST K++GGNRRRP NIGDV+V+VPGLRIP Sbjct: 1 MGCIFSTPKDTGGNRRRPGNIGDVSVYVPGLRIP 34 >ref|XP_004495492.1| PREDICTED: uncharacterized protein LOC101515213 isoform X1 [Cicer arietinum] gi|502116567|ref|XP_004495493.1| PREDICTED: uncharacterized protein LOC101515213 isoform X2 [Cicer arietinum] gi|502116569|ref|XP_004495494.1| PREDICTED: uncharacterized protein LOC101515213 isoform X3 [Cicer arietinum] gi|502116571|ref|XP_004495495.1| PREDICTED: uncharacterized protein LOC101515213 isoform X4 [Cicer arietinum] gi|502116573|ref|XP_004495496.1| PREDICTED: uncharacterized protein LOC101515213 isoform X5 [Cicer arietinum] gi|502116575|ref|XP_004495497.1| PREDICTED: uncharacterized protein LOC101515213 isoform X6 [Cicer arietinum] Length = 425 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC+VST K+SGGNRRRPA+IG+V+V+VPGLRIP Sbjct: 1 MGCMVSTPKDSGGNRRRPASIGEVSVYVPGLRIP 34 >ref|XP_004299454.1| PREDICTED: uncharacterized protein LOC101309446 [Fragaria vesca subsp. vesca] Length = 342 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC+VST K++GGNRRRP+NIG+V+V+VPGLRIP Sbjct: 1 MGCLVSTPKDTGGNRRRPSNIGEVSVYVPGLRIP 34 >ref|XP_007152520.1| hypothetical protein PHAVU_004G137200g [Phaseolus vulgaris] gi|561025829|gb|ESW24514.1| hypothetical protein PHAVU_004G137200g [Phaseolus vulgaris] Length = 425 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC+VST K+SGGNRRRP +IG+V+V+VPGLRIP Sbjct: 1 MGCVVSTPKDSGGNRRRPGSIGEVSVYVPGLRIP 34 >ref|XP_003534075.1| PREDICTED: uncharacterized protein LOC100820472 [Glycine max] Length = 425 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC+VST K+SGGNRRRP +IG+V+V+VPGLRIP Sbjct: 1 MGCVVSTTKDSGGNRRRPGSIGEVSVYVPGLRIP 34 >ref|XP_006351540.1| PREDICTED: uncharacterized protein LOC102579226 isoform X1 [Solanum tuberosum] gi|565369840|ref|XP_006351541.1| PREDICTED: uncharacterized protein LOC102579226 isoform X2 [Solanum tuberosum] gi|565369842|ref|XP_006351542.1| PREDICTED: uncharacterized protein LOC102579226 isoform X3 [Solanum tuberosum] Length = 417 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC VST +++GGNRRRP NIG+V+VFVPGLRIP Sbjct: 1 MGCFVSTPQDTGGNRRRPGNIGEVSVFVPGLRIP 34 >ref|XP_006589244.1| PREDICTED: uncharacterized protein LOC100813397 isoform X3 [Glycine max] Length = 400 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC VST K+SGGNRRRP +IG+V+V+VPGLRIP Sbjct: 1 MGCFVSTPKDSGGNRRRPGSIGEVSVYVPGLRIP 34 >ref|XP_006478139.1| PREDICTED: uncharacterized protein LOC102623639 isoform X1 [Citrus sinensis] gi|568848709|ref|XP_006478140.1| PREDICTED: uncharacterized protein LOC102623639 isoform X2 [Citrus sinensis] Length = 427 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC +ST K++GGNRRRP NIG+V+V+VPGLRIP Sbjct: 1 MGCFLSTSKDTGGNRRRPGNIGEVSVYVPGLRIP 34 >ref|XP_006441473.1| hypothetical protein CICLE_v10021034mg [Citrus clementina] gi|557543735|gb|ESR54713.1| hypothetical protein CICLE_v10021034mg [Citrus clementina] Length = 337 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC +ST K++GGNRRRP NIG+V+V+VPGLRIP Sbjct: 1 MGCFLSTSKDTGGNRRRPGNIGEVSVYVPGLRIP 34 >ref|XP_003556420.1| PREDICTED: uncharacterized protein LOC100781733 isoform X1 [Glycine max] gi|571569594|ref|XP_006606414.1| PREDICTED: uncharacterized protein LOC100781733 isoform X2 [Glycine max] Length = 425 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC VST K+SGGNRRRP +IG+V+V+VPGLRIP Sbjct: 1 MGCFVSTPKDSGGNRRRPGSIGEVSVYVPGLRIP 34 >ref|XP_006589242.1| PREDICTED: uncharacterized protein LOC100813397 isoform X1 [Glycine max] gi|571483452|ref|XP_006589243.1| PREDICTED: uncharacterized protein LOC100813397 isoform X2 [Glycine max] Length = 425 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC VST K+SGGNRRRP +IG+V+V+VPGLRIP Sbjct: 1 MGCFVSTPKDSGGNRRRPGSIGEVSVYVPGLRIP 34 >ref|XP_004512801.1| PREDICTED: uncharacterized protein LOC101512481 isoform X1 [Cicer arietinum] gi|502163321|ref|XP_004512802.1| PREDICTED: uncharacterized protein LOC101512481 isoform X2 [Cicer arietinum] Length = 426 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC+VST K+SGGNRR+P +IG+V+V+VPGLRIP Sbjct: 1 MGCLVSTPKDSGGNRRKPGSIGEVSVYVPGLRIP 34 >ref|XP_007209163.1| hypothetical protein PRUPE_ppa006106mg [Prunus persica] gi|462404898|gb|EMJ10362.1| hypothetical protein PRUPE_ppa006106mg [Prunus persica] Length = 427 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC+VST K++ GNRRRPANIG+V+V+VPGLRIP Sbjct: 1 MGCLVSTPKDTVGNRRRPANIGEVSVYVPGLRIP 34 >ref|XP_004234329.1| PREDICTED: uncharacterized protein LOC101254569 [Solanum lycopersicum] Length = 417 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC +ST +++GGNRRRP NIG+V+VFVPGLRIP Sbjct: 1 MGCFLSTPQDTGGNRRRPGNIGEVSVFVPGLRIP 34 >ref|XP_002305035.1| hypothetical protein POPTR_0004s06600g [Populus trichocarpa] gi|118488314|gb|ABK95976.1| unknown [Populus trichocarpa] gi|222847999|gb|EEE85546.1| hypothetical protein POPTR_0004s06600g [Populus trichocarpa] Length = 425 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGC+VST ++SGGNRRRP +IGDV+V+VPG RIP Sbjct: 1 MGCLVSTPQDSGGNRRRPGSIGDVSVYVPGFRIP 34 >gb|AFK48379.1| unknown [Medicago truncatula] Length = 427 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 303 MGCIVSTQKESGGNRRRPANIGDVAVFVPGLRIP 404 MGCI ST K+SGGNRRRP +IG+V+V+VPGLRIP Sbjct: 1 MGCIGSTPKDSGGNRRRPGSIGEVSVYVPGLRIP 34