BLASTX nr result
ID: Mentha23_contig00027537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00027537 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356647.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_004245260.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 >ref|XP_006356647.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X1 [Solanum tuberosum] gi|565380524|ref|XP_006356648.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Solanum tuberosum] Length = 629 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/82 (42%), Positives = 50/82 (60%), Gaps = 3/82 (3%) Frame = +1 Query: 76 IEKFDREKGNLETNSTKQGSSLAKHVQDL-PFN--DTSLDEKLHFHPMPESTLCTICTGG 246 ++ F +E+ N E + K G + L PF+ + LD+K+ P PES+LC C G Sbjct: 1 MDDFRKERSNCEKSRRKSGMKTLIRKELLHPFSIKEKDLDDKMPLQPTPESSLCAFCVNG 60 Query: 247 ESCKIVRSRTKLMNILLERGKP 312 SC+ VR+RTKLMN +LERG+P Sbjct: 61 NSCRTVRARTKLMNTVLERGRP 82 >ref|XP_004245260.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Solanum lycopersicum] Length = 629 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 3/82 (3%) Frame = +1 Query: 76 IEKFDREKGNLETNSTKQGSSLAKHVQDL-PFN--DTSLDEKLHFHPMPESTLCTICTGG 246 ++ F +E+ N E + K G + L PF+ + L++K+ P PES+LC C G Sbjct: 1 MDDFRKERSNCENSRRKSGMKTLIRKEFLHPFSIKEKDLEDKMPLRPTPESSLCAFCVNG 60 Query: 247 ESCKIVRSRTKLMNILLERGKP 312 SC+ VR+RTKLMN +LERG+P Sbjct: 61 NSCRTVRARTKLMNTVLERGRP 82