BLASTX nr result
ID: Mentha23_contig00026817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00026817 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39947.1| hypothetical protein MIMGU_mgv1a009191mg [Mimulus... 57 3e-06 >gb|EYU39947.1| hypothetical protein MIMGU_mgv1a009191mg [Mimulus guttatus] Length = 350 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 118 MTPVCPFNKASRPDDASGKKSSENQSKQLAASDNKTQPD 2 MTPVCPF KASRPDDAS K+ ENQ+KQ +D+K+Q + Sbjct: 1 MTPVCPFTKASRPDDASCKRPGENQNKQQTVNDSKSQQE 39