BLASTX nr result
ID: Mentha23_contig00026768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00026768 (446 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27461.1| hypothetical protein MIMGU_mgv1a011482mg [Mimulus... 59 7e-07 ref|XP_004244025.1| PREDICTED: E3 ubiquitin-protein ligase At4g1... 56 6e-06 >gb|EYU27461.1| hypothetical protein MIMGU_mgv1a011482mg [Mimulus guttatus] Length = 280 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +2 Query: 323 SGEEKHVRPMRIWVLGYAFGSFLSLILLLWRYHFVYL 433 SG E+ V PMRIWV GYAFG FLSL+LL WRY VYL Sbjct: 113 SGGERPVWPMRIWVSGYAFGCFLSLVLLSWRYRLVYL 149 >ref|XP_004244025.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Solanum lycopersicum] Length = 329 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +2 Query: 329 EEKHVRPMRIWVLGYAFGSFLSLILLLWRYHFVYLSQSN 445 +E+ V PMRIWV GY FG +SLILL WRY +Y+SQ+N Sbjct: 112 DERPVWPMRIWVFGYGFGCVISLILLYWRYWVLYVSQTN 150