BLASTX nr result
ID: Mentha23_contig00026147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00026147 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34107.1| hypothetical protein MIMGU_mgv1a0009452mg, partia... 71 1e-10 >gb|EYU34107.1| hypothetical protein MIMGU_mgv1a0009452mg, partial [Mimulus guttatus] Length = 464 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 4/67 (5%) Frame = +1 Query: 247 RKDWPHVVPPW----HQECSIREAYISRHTTLNQFKYFDPQIFESFLVGKPPHHLLFNKN 414 R++W +V P W +Q S+REAY+ RHT L QFKY DP VGK PH +LF+KN Sbjct: 59 RQEWQNVAPLWPNGSNQSSSMREAYLFRHTALRQFKYVDPLFRHIPTVGKRPHQILFDKN 118 Query: 415 SIILSQG 435 +I+ SQG Sbjct: 119 TILFSQG 125