BLASTX nr result
ID: Mentha23_contig00025993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025993 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21649.1| hypothetical protein MIMGU_mgv1a013574mg [Mimulus... 69 5e-10 >gb|EYU21649.1| hypothetical protein MIMGU_mgv1a013574mg [Mimulus guttatus] Length = 216 Score = 69.3 bits (168), Expect = 5e-10 Identities = 38/59 (64%), Positives = 41/59 (69%), Gaps = 5/59 (8%) Frame = -3 Query: 335 KDVFVLSLKPGVDGAFAMGLVLILDQIH-----XXXXXXXXAENGSKVGVDPTSEDSNL 174 KDVFVLSLKPG DGAFAMGLVL+LD I +ENGS+VGVDPT EDS L Sbjct: 157 KDVFVLSLKPGFDGAFAMGLVLVLDHIQGDDEVDGDDDGDGSENGSRVGVDPTHEDSTL 215