BLASTX nr result
ID: Mentha23_contig00025980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025980 (591 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22788.1| hypothetical protein MIMGU_mgv1a017639mg [Mimulus... 57 4e-06 >gb|EYU22788.1| hypothetical protein MIMGU_mgv1a017639mg [Mimulus guttatus] Length = 119 Score = 57.0 bits (136), Expect = 4e-06 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 6/71 (8%) Frame = -2 Query: 371 SPFLIPLLCATCPIICAVELCYLM------SXXXXXXXXXXXXXXXXXXDEVGLLQRYLE 210 SPF+ PL ATCP+ICAVE+C L+ + DEVGLLQRYL+ Sbjct: 20 SPFIFPLFFATCPLICAVEICCLVRRKRRTADADAGGGDGWWSREGDGGDEVGLLQRYLD 79 Query: 209 DQLTLVAEPPY 177 DQL+LVA Y Sbjct: 80 DQLSLVAGSVY 90