BLASTX nr result
ID: Mentha23_contig00025957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025957 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31043.1| hypothetical protein MIMGU_mgv1a018151mg, partial... 70 2e-10 >gb|EYU31043.1| hypothetical protein MIMGU_mgv1a018151mg, partial [Mimulus guttatus] Length = 503 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/51 (68%), Positives = 41/51 (80%), Gaps = 7/51 (13%) Frame = +2 Query: 260 PIVYSARLVHRFSDEARAH---RDSRNGAEV----GGVDFWPQRRSLEYYR 391 PIVYSAR+VHRFSDEARAH RD +NGA+V GG+ FWP+RRS E+YR Sbjct: 6 PIVYSARVVHRFSDEARAHRVFRDLKNGAQVAGGGGGLGFWPERRSFEFYR 56