BLASTX nr result
ID: Mentha23_contig00025503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025503 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28722.1| hypothetical protein MIMGU_mgv1a007163mg [Mimulus... 57 3e-06 ref|XP_002277256.1| PREDICTED: protein kinase 2B, chloroplastic ... 55 8e-06 >gb|EYU28722.1| hypothetical protein MIMGU_mgv1a007163mg [Mimulus guttatus] Length = 417 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 3 AVQCLSHEAKQRPRMADVLAKLEELQAPKTATRHLKVESKGDN 131 A+QCLSHEAK RPRMADV+ KLEELQAPK+ + KV + +N Sbjct: 340 ALQCLSHEAKLRPRMADVIDKLEELQAPKSGIANRKVVVQIEN 382 >ref|XP_002277256.1| PREDICTED: protein kinase 2B, chloroplastic [Vitis vinifera] gi|296086406|emb|CBI31995.3| unnamed protein product [Vitis vinifera] Length = 420 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/49 (48%), Positives = 38/49 (77%) Frame = +3 Query: 3 AVQCLSHEAKQRPRMADVLAKLEELQAPKTATRHLKVESKGDNVPILQS 149 A+QCL+ EAK RPRM++VLA LE++Q+PK A +H++ E ++P+ +S Sbjct: 344 ALQCLNTEAKVRPRMSEVLATLEQIQSPKNAAKHIQSEQHTVSIPVQKS 392