BLASTX nr result
ID: Mentha23_contig00025403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025403 (1889 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22203.1| hypothetical protein MIMGU_mgv1a021448mg [Mimulus... 55 5e-06 gb|EYU39419.1| hypothetical protein MIMGU_mgv1a010384mg [Mimulus... 59 6e-06 gb|EYU22202.1| hypothetical protein MIMGU_mgv1a005074mg [Mimulus... 55 6e-06 >gb|EYU22203.1| hypothetical protein MIMGU_mgv1a021448mg [Mimulus guttatus] Length = 502 Score = 55.1 bits (131), Expect(2) = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 1701 KRLR*NCIDLGSAPY*KYWRKMKSIFVLQLLSRKRVQSF 1817 KRL NC D+ APY +YWR++KSI VLQLLS KRVQSF Sbjct: 111 KRLLYNCKDVSIAPYGEYWRQLKSICVLQLLSNKRVQSF 149 Score = 24.3 bits (51), Expect(2) = 5e-06 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 1816 FPYIRDEEAALRVKKVR 1866 F YIR+EE AL +K+++ Sbjct: 149 FHYIREEETALLMKRIK 165 >gb|EYU39419.1| hypothetical protein MIMGU_mgv1a010384mg [Mimulus guttatus] Length = 313 Score = 59.3 bits (142), Expect = 6e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -3 Query: 1134 RLIDESKHCNLKSAHPSGLSAHMGFFGCRVFS 1039 RLIDESKH LKSAHPSGLSAH GFFGCR FS Sbjct: 264 RLIDESKHYVLKSAHPSGLSAHRGFFGCRHFS 295 >gb|EYU22202.1| hypothetical protein MIMGU_mgv1a005074mg [Mimulus guttatus] Length = 497 Score = 55.1 bits (131), Expect(2) = 6e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 1701 KRLR*NCIDLGSAPY*KYWRKMKSIFVLQLLSRKRVQSF 1817 KRL NC D+ APY +YWR++KSI VLQLLS KRVQSF Sbjct: 111 KRLLYNCKDVSIAPYGEYWRQLKSICVLQLLSNKRVQSF 149 Score = 23.9 bits (50), Expect(2) = 6e-06 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 1816 FPYIRDEEAALRVKKVRETKYA 1881 F YIR+EE AL +K++ E +Y+ Sbjct: 149 FHYIREEETALLMKRI-EREYS 169