BLASTX nr result
ID: Mentha23_contig00025347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025347 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17894.1| hypothetical protein MIMGU_mgv1a010500mg [Mimulus... 60 4e-07 >gb|EYU17894.1| hypothetical protein MIMGU_mgv1a010500mg [Mimulus guttatus] Length = 310 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Frame = -1 Query: 243 AAMALEQTLALNNTLLLHRIPTPIPQFQFRSLNPNAARRLVPALRVKCSFDYSGAGAAPR 64 A AL+QTLAL NT+L+++ P+PI F F SLN + L RVKCSF Y+ G A Sbjct: 4 AMAALDQTLALKNTVLIYQNPSPISCFPFLSLNSKSLTTLASTARVKCSFGYNSGGTATN 63 Query: 63 -SNSG 52 SN+G Sbjct: 64 TSNNG 68