BLASTX nr result
ID: Mentha23_contig00025331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025331 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37854.1| hypothetical protein MIMGU_mgv1a000112mg [Mimulus... 55 8e-06 >gb|EYU37854.1| hypothetical protein MIMGU_mgv1a000112mg [Mimulus guttatus] Length = 1754 Score = 55.5 bits (132), Expect = 8e-06 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 24/127 (18%) Frame = +1 Query: 4 DPQLEKKEEEVSTPTVDAKMEVADTDAGYEQQLSELQTDANVGGGELNPAMEEVEAR--- 174 DPQ+ + E+ TP VD +E TDA SELQ D+NV EL+ +E +EA Sbjct: 213 DPQIVSEAEQEFTPAVDPIVEGVVTDASDAHNFSELQVDSNV--DELHATVEGIEAEDYK 270 Query: 175 -HNELSNEEHDEALGG----------AARSDEVAESDE----------VALMENDSEFGV 291 ++ E+ +A+GG A ++ V + DE V +ENDSE G Sbjct: 271 SEGDMDEGENVKAVGGLDNESADSLIEANTETVVKDDEIKDDEVDEPKVDFVENDSEVGA 330 Query: 292 AERSEEV 312 AE+ +V Sbjct: 331 AEKPADV 337