BLASTX nr result
ID: Mentha23_contig00025255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025255 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43998.1| hypothetical protein MIMGU_mgv1a015325mg [Mimulus... 59 9e-07 >gb|EYU43998.1| hypothetical protein MIMGU_mgv1a015325mg [Mimulus guttatus] Length = 161 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 93 MMDLSDKGSECEEMSSQTPAPDSVSSDGSNV 1 MMDLSDKGSECE+MSS TP PD VSSDGSNV Sbjct: 1 MMDLSDKGSECEDMSSPTPTPDRVSSDGSNV 31