BLASTX nr result
ID: Mentha23_contig00025138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025138 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43149.1| hypothetical protein MIMGU_mgv1a000121mg [Mimulus... 57 3e-06 >gb|EYU43149.1| hypothetical protein MIMGU_mgv1a000121mg [Mimulus guttatus] Length = 1722 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/77 (40%), Positives = 39/77 (50%), Gaps = 3/77 (3%) Frame = -3 Query: 227 QLKELDDLLVHASLCQEDLVLGEGFVARCPYPKCYNGQVCYRHIYFCTGR---GCRLCNS 57 QL+++ DLLVHAS C+ L C YP C + +RH C R GC LC Sbjct: 1613 QLRKMLDLLVHASQCRSSL---------CQYPNCRKVKGLFRHGMLCKVRASAGCPLCKK 1663 Query: 56 MLELVKFHAGQCTAPNC 6 M L++ HA C PNC Sbjct: 1664 MWYLLQIHARACKDPNC 1680