BLASTX nr result
ID: Mentha23_contig00025031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00025031 (494 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21772.1| hypothetical protein MIMGU_mgv1a011557mg [Mimulus... 100 3e-19 gb|ABG35768.1| NOX3 [Striga asiatica] 97 3e-18 gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea] 95 1e-17 gb|EYU24549.1| hypothetical protein MIMGU_mgv1a001003mg [Mimulus... 92 7e-17 gb|ADR70880.1| respiratory burst oxidase A [Manihot esculenta] 92 1e-16 ref|XP_002511059.1| respiratory burst oxidase, putative [Ricinus... 86 4e-15 gb|EYU24552.1| hypothetical protein MIMGU_mgv1a001077mg [Mimulus... 86 7e-15 gb|EXC32352.1| Respiratory burst oxidase-like protein D [Morus n... 85 9e-15 ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog... 85 9e-15 ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citr... 85 9e-15 ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog... 85 1e-14 gb|ADR70892.1| respiratory burst oxidase C [Manihot esculenta] 84 3e-14 ref|XP_002318793.2| respiratory burst oxidase C family protein [... 84 3e-14 ref|XP_006485050.1| PREDICTED: respiratory burst oxidase homolog... 83 3e-14 ref|XP_006437008.1| hypothetical protein CICLE_v10030649mg [Citr... 83 3e-14 ref|XP_003602726.1| Respiratory burst oxidase-like protein [Medi... 83 3e-14 gb|ADR70882.1| respiratory burst oxidase D [Manihot esculenta] 82 1e-13 ref|XP_002322314.2| respiratory burst oxidase C family protein [... 82 1e-13 ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Popu... 81 1e-13 ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog... 81 2e-13 >gb|EYU21772.1| hypothetical protein MIMGU_mgv1a011557mg [Mimulus guttatus] Length = 277 Score = 100 bits (248), Expect = 3e-19 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD Sbjct: 217 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 261 >gb|ABG35768.1| NOX3 [Striga asiatica] Length = 542 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWRTVYKRIALNHP +RVGVFYCGAPPPVKELRQLASD Sbjct: 465 KSHFAKPNWRTVYKRIALNHPTARVGVFYCGAPPPVKELRQLASD 509 >gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea] Length = 887 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 491 SHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 SHFAKPNWRTVYKRIALNHP +RVGVFYCGAPPPVKELRQLASD Sbjct: 828 SHFAKPNWRTVYKRIALNHPETRVGVFYCGAPPPVKELRQLASD 871 >gb|EYU24549.1| hypothetical protein MIMGU_mgv1a001003mg [Mimulus guttatus] Length = 916 Score = 92.0 bits (227), Expect = 7e-17 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYK IA+NHPN+RVGVFYCGAPPPV+ELRQLASD Sbjct: 856 KSHFAKPNWREVYKSIAVNHPNARVGVFYCGAPPPVRELRQLASD 900 >gb|ADR70880.1| respiratory burst oxidase A [Manihot esculenta] Length = 908 Score = 91.7 bits (226), Expect = 1e-16 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAP KELRQLASD Sbjct: 848 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPALTKELRQLASD 892 >ref|XP_002511059.1| respiratory burst oxidase, putative [Ricinus communis] gi|223550174|gb|EEF51661.1| respiratory burst oxidase, putative [Ricinus communis] Length = 910 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR+VYKR ALNHPNSRVGVFYCGAP KELR LASD Sbjct: 850 KSHFAKPNWRSVYKRTALNHPNSRVGVFYCGAPALTKELRHLASD 894 >gb|EYU24552.1| hypothetical protein MIMGU_mgv1a001077mg [Mimulus guttatus] Length = 894 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 491 SHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLAS 363 SHFAKPNWRTVYKRIALNHP + VGVF+CGAP PVKELRQLAS Sbjct: 835 SHFAKPNWRTVYKRIALNHPETTVGVFFCGAPAPVKELRQLAS 877 >gb|EXC32352.1| Respiratory burst oxidase-like protein D [Morus notabilis] Length = 924 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYKRIAL HP+SRVGVFYCGAP KELRQLASD Sbjct: 864 KSHFAKPNWRQVYKRIALQHPHSRVGVFYCGAPALTKELRQLASD 908 >ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Citrus sinensis] Length = 915 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYKRIAL+HP+SR+GVFYCGAP KELRQLASD Sbjct: 855 KSHFAKPNWRQVYKRIALHHPDSRIGVFYCGAPALTKELRQLASD 899 >ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citrus clementina] gi|557525818|gb|ESR37124.1| hypothetical protein CICLE_v10027774mg [Citrus clementina] Length = 912 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYKRIAL+HP+SR+GVFYCGAP KELRQLASD Sbjct: 852 KSHFAKPNWRQVYKRIALHHPDSRIGVFYCGAPALTKELRQLASD 896 >ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer arietinum] Length = 927 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR+VYKRIALNHP +RVGVFYCG P KELRQLASD Sbjct: 867 KSHFAKPNWRSVYKRIALNHPQARVGVFYCGLPALAKELRQLASD 911 >gb|ADR70892.1| respiratory burst oxidase C [Manihot esculenta] Length = 882 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYKRIALNHP+SRVGVFYCGAP KELR LA D Sbjct: 822 KSHFAKPNWRNVYKRIALNHPDSRVGVFYCGAPALTKELRHLALD 866 >ref|XP_002318793.2| respiratory burst oxidase C family protein [Populus trichocarpa] gi|550326872|gb|EEE97013.2| respiratory burst oxidase C family protein [Populus trichocarpa] Length = 909 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYKR ALNHP+SRVGVFYCGAP KELRQLA D Sbjct: 849 KSHFAKPNWRNVYKRTALNHPDSRVGVFYCGAPALTKELRQLALD 893 >ref|XP_006485050.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Citrus sinensis] Length = 929 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYKR+ALNHP+SRVGVFYCGAP KELR LA D Sbjct: 869 KSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALD 913 >ref|XP_006437008.1| hypothetical protein CICLE_v10030649mg [Citrus clementina] gi|557539204|gb|ESR50248.1| hypothetical protein CICLE_v10030649mg [Citrus clementina] Length = 929 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYKR+ALNHP+SRVGVFYCGAP KELR LA D Sbjct: 869 KSHFAKPNWRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALD 913 >ref|XP_003602726.1| Respiratory burst oxidase-like protein [Medicago truncatula] gi|355491774|gb|AES72977.1| Respiratory burst oxidase-like protein [Medicago truncatula] Length = 923 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR+VYKRIALNHP +RVGVFYCG P KELRQL SD Sbjct: 863 KSHFAKPNWRSVYKRIALNHPQTRVGVFYCGPPALTKELRQLGSD 907 >gb|ADR70882.1| respiratory burst oxidase D [Manihot esculenta] Length = 914 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYK+IAL HPN R+GVFYCGAP KELRQLA D Sbjct: 854 KSHFAKPNWRQVYKKIALQHPNGRIGVFYCGAPALTKELRQLALD 898 >ref|XP_002322314.2| respiratory burst oxidase C family protein [Populus trichocarpa] gi|550322544|gb|EEF06441.2| respiratory burst oxidase C family protein [Populus trichocarpa] Length = 915 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKP+WR VYKR ALNHP+SRVGVFYCGAP KELRQLA D Sbjct: 855 KSHFAKPDWRNVYKRTALNHPDSRVGVFYCGAPALTKELRQLALD 899 >ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa] gi|550343272|gb|EEE78715.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa] Length = 926 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYK+IAL HP+SR+GVFYCGAP KELRQLA D Sbjct: 866 KSHFAKPNWRQVYKKIALQHPDSRIGVFYCGAPALTKELRQLALD 910 >ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Fragaria vesca subsp. vesca] Length = 935 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -1 Query: 494 KSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 360 KSHFAKPNWR VYK+IAL+HP+SRVGVFYCGAP KEL+QLA D Sbjct: 875 KSHFAKPNWRQVYKKIALHHPDSRVGVFYCGAPALTKELKQLALD 919