BLASTX nr result
ID: Mentha23_contig00024879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00024879 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342141.1| PREDICTED: probable serine/threonine-protein... 57 2e-06 >ref|XP_006342141.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like [Solanum tuberosum] Length = 417 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +3 Query: 3 AYATAELILKCLEPDPKSRPDMESVLECLENISQIQM 113 A+ AE+ILKCLEPDPK+RP ME +LECLE + IQM Sbjct: 337 AFQIAEIILKCLEPDPKNRPSMEEILECLEQCNGIQM 373