BLASTX nr result
ID: Mentha23_contig00024642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00024642 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66817.1| hypothetical protein M569_07959, partial [Genlise... 55 8e-06 >gb|EPS66817.1| hypothetical protein M569_07959, partial [Genlisea aurea] Length = 460 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/47 (61%), Positives = 30/47 (63%) Frame = +3 Query: 270 RGTEMSASLAAFERPRNVNSNTIFKSGHLLIXXXXXXXXXXXXRWFI 410 + MSASLAAFERPR NSNTIFKSGHLLI RWFI Sbjct: 14 KACRMSASLAAFERPRIGNSNTIFKSGHLLISSKGLGWKSWKKRWFI 60