BLASTX nr result
ID: Mentha23_contig00024594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00024594 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476346.1| PREDICTED: 26S proteasome non-ATPase regulat... 72 8e-11 ref|XP_006439298.1| hypothetical protein CICLE_v10021697mg [Citr... 72 8e-11 gb|ABI31652.1| 26S proteasome regulatory particle non-ATPase sub... 72 8e-11 ref|XP_002264255.1| PREDICTED: 26S proteasome non-ATPase regulat... 72 1e-10 ref|XP_007029492.1| Regulatory particle non-ATPase 12A isoform 1... 71 2e-10 ref|XP_007158973.1| hypothetical protein PHAVU_002G197600g [Phas... 70 3e-10 gb|AFK41352.1| unknown [Lotus japonicus] 70 3e-10 ref|NP_001241171.1| uncharacterized protein LOC100785835 [Glycin... 70 3e-10 ref|XP_006391610.1| hypothetical protein EUTSA_v10023640mg [Eutr... 69 5e-10 ref|XP_004972575.1| PREDICTED: 26S proteasome non-ATPase regulat... 69 5e-10 ref|XP_007029493.1| Regulatory particle non-ATPase 12A isoform 2... 69 5e-10 ref|XP_006302691.1| hypothetical protein CARUB_v10020801mg [Caps... 69 5e-10 ref|NP_176633.1| 26S proteasome non-ATPase regulatory subunit RP... 69 5e-10 ref|XP_002887880.1| hypothetical protein ARALYDRAFT_474895 [Arab... 69 5e-10 ref|XP_002444030.1| hypothetical protein SORBIDRAFT_07g006120 [S... 69 5e-10 gb|ACG40420.1| 26S proteasome non-ATPase regulatory subunit 8 [Z... 69 5e-10 ref|NP_001131539.1| 26S proteasome non-ATPase regulatory subunit... 69 5e-10 gb|AAP86674.1| 26S proteasome subunit RPN12 [Arabidopsis thaliana] 69 5e-10 ref|XP_004498915.1| PREDICTED: 26S proteasome non-ATPase regulat... 69 7e-10 ref|XP_006852595.1| hypothetical protein AMTR_s00021p00218440 [A... 69 9e-10 >ref|XP_006476346.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Citrus sinensis] Length = 267 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 GFVFFQ+AK+S PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GFVFFQKAKDSAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_006439298.1| hypothetical protein CICLE_v10021697mg [Citrus clementina] gi|557541560|gb|ESR52538.1| hypothetical protein CICLE_v10021697mg [Citrus clementina] Length = 267 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 GFVFFQ+AK+S PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GFVFFQKAKDSAPCKEIPSLQLINQTLSYARELERIV 267 >gb|ABI31652.1| 26S proteasome regulatory particle non-ATPase subunit 12 [Camellia sinensis] Length = 267 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 GFV FQRAKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GFVIFQRAKESAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_002264255.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit RPN12A [Vitis vinifera] gi|297742385|emb|CBI34534.3| unnamed protein product [Vitis vinifera] Length = 267 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQRAKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GHVFFQRAKESAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_007029492.1| Regulatory particle non-ATPase 12A isoform 1 [Theobroma cacao] gi|508718097|gb|EOY09994.1| Regulatory particle non-ATPase 12A isoform 1 [Theobroma cacao] Length = 267 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 GFVF Q+AKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GFVFLQKAKESAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_007158973.1| hypothetical protein PHAVU_002G197600g [Phaseolus vulgaris] gi|561032388|gb|ESW30967.1| hypothetical protein PHAVU_002G197600g [Phaseolus vulgaris] Length = 267 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQ+AKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GSVFFQKAKESAPCKEIPSLQLINQTLSYARELERIV 267 >gb|AFK41352.1| unknown [Lotus japonicus] Length = 124 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQ+AKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 88 GSVFFQKAKESAPCKEIPSLQLINQTLSYARELERIV 124 >ref|NP_001241171.1| uncharacterized protein LOC100785835 [Glycine max] gi|255634606|gb|ACU17665.1| unknown [Glycine max] Length = 267 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQ+AKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GSVFFQKAKESAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_006391610.1| hypothetical protein EUTSA_v10023640mg [Eutrema salsugineum] gi|557088116|gb|ESQ28896.1| hypothetical protein EUTSA_v10023640mg [Eutrema salsugineum] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 GFV FQ+AKE+ PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GFVVFQKAKETAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_004972575.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit RPN12A-like [Setaria italica] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQ+AKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GSVFFQKAKESQPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_007029493.1| Regulatory particle non-ATPase 12A isoform 2, partial [Theobroma cacao] gi|508718098|gb|EOY09995.1| Regulatory particle non-ATPase 12A isoform 2, partial [Theobroma cacao] Length = 194 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERI 109 GFVF Q+AKES PCKEIPSLQLINQTLSYARELERI Sbjct: 159 GFVFLQKAKESAPCKEIPSLQLINQTLSYARELERI 194 >ref|XP_006302691.1| hypothetical protein CARUB_v10020801mg [Capsella rubella] gi|482571401|gb|EOA35589.1| hypothetical protein CARUB_v10020801mg [Capsella rubella] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 GFV FQ+AKE+ PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GFVVFQKAKETAPCKEIPSLQLINQTLSYARELERIV 267 >ref|NP_176633.1| 26S proteasome non-ATPase regulatory subunit RPN12A [Arabidopsis thaliana] gi|75205191|sp|Q9SGW3.1|PSD8A_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 8 homolog A; AltName: Full=26S proteasome regulatory subunit RPN12a; Short=AtRPN12a; AltName: Full=26S proteasome regulatory subunit S14 homolog A gi|6633812|gb|AAF19671.1|AC009519_5 F1N19.9 [Arabidopsis thaliana] gi|15294148|gb|AAK95251.1|AF410265_1 At1g64520/F1N19_10 [Arabidopsis thaliana] gi|14532466|gb|AAK63961.1| At1g64520/F1N19_10 [Arabidopsis thaliana] gi|23505935|gb|AAN28827.1| At1g64520/F1N19_10 [Arabidopsis thaliana] gi|32700046|gb|AAP86673.1| 26S proteasome subunit RPN12 [Arabidopsis thaliana] gi|332196128|gb|AEE34249.1| 26S proteasome non-ATPase regulatory subunit RPN12A [Arabidopsis thaliana] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 GFV FQ+AKE+ PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GFVVFQKAKETAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_002887880.1| hypothetical protein ARALYDRAFT_474895 [Arabidopsis lyrata subsp. lyrata] gi|297333721|gb|EFH64139.1| hypothetical protein ARALYDRAFT_474895 [Arabidopsis lyrata subsp. lyrata] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 GFV FQ+AKE+ PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GFVVFQKAKETAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_002444030.1| hypothetical protein SORBIDRAFT_07g006120 [Sorghum bicolor] gi|241940380|gb|EES13525.1| hypothetical protein SORBIDRAFT_07g006120 [Sorghum bicolor] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQ+AKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GAVFFQKAKESQPCKEIPSLQLINQTLSYARELERIV 267 >gb|ACG40420.1| 26S proteasome non-ATPase regulatory subunit 8 [Zea mays] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQ+AKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GAVFFQKAKESQPCKEIPSLQLINQTLSYARELERIV 267 >ref|NP_001131539.1| 26S proteasome non-ATPase regulatory subunit 8 [Zea mays] gi|194691796|gb|ACF79982.1| unknown [Zea mays] gi|195640678|gb|ACG39807.1| 26S proteasome non-ATPase regulatory subunit 8 [Zea mays] gi|414875884|tpg|DAA53015.1| TPA: 26S proteasome non-ATPase regulatory subunit 8 [Zea mays] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQ+AKES PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GAVFFQKAKESQPCKEIPSLQLINQTLSYARELERIV 267 >gb|AAP86674.1| 26S proteasome subunit RPN12 [Arabidopsis thaliana] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 GFV FQ+AKE+ PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GFVVFQKAKETAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_004498915.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit RPN12A-like [Cicer arietinum] Length = 267 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQ+AK+S PCKEIPSLQLINQTLSYARELERIV Sbjct: 231 GSVFFQKAKDSAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_006852595.1| hypothetical protein AMTR_s00021p00218440 [Amborella trichopoda] gi|548856206|gb|ERN14062.1| hypothetical protein AMTR_s00021p00218440 [Amborella trichopoda] Length = 267 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 2 GFVFFQRAKESVPCKEIPSLQLINQTLSYARELERIV 112 G VFFQ+AKES PCKEIPSLQLINQTL YARELERIV Sbjct: 231 GCVFFQKAKESAPCKEIPSLQLINQTLGYARELERIV 267