BLASTX nr result
ID: Mentha23_contig00023488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00023488 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432747.1| hypothetical protein CICLE_v10002003mg [Citr... 97 2e-18 gb|ABC96720.1| plastid fibrillin 2 [Coffea canephora] 94 1e-17 ref|XP_006352897.1| PREDICTED: plastoglobulin-1, chloroplastic-l... 94 2e-17 ref|XP_004148751.1| PREDICTED: plastid lipid-associated protein ... 93 3e-17 ref|XP_002518975.1| Plastid lipid-associated protein 3, chloropl... 93 4e-17 gb|EYU19055.1| hypothetical protein MIMGU_mgv1a026687mg, partial... 92 6e-17 emb|CBI33829.3| unnamed protein product [Vitis vinifera] 92 7e-17 ref|XP_002276479.1| PREDICTED: probable plastid-lipid-associated... 92 7e-17 gb|EXB66511.1| putative plastid-lipid-associated protein 3 [Moru... 91 1e-16 ref|XP_004512496.1| PREDICTED: plastoglobulin-1, chloroplastic-l... 91 1e-16 ref|XP_004245973.1| PREDICTED: plastid lipid-associated protein ... 91 1e-16 ref|XP_003516983.1| PREDICTED: plastoglobulin-1, chloroplastic-l... 91 1e-16 ref|XP_007158264.1| hypothetical protein PHAVU_002G137800g [Phas... 89 5e-16 sp|Q9ZP40.1|PG1_PEA RecName: Full=Plastoglobulin-1, chloroplasti... 88 1e-15 ref|XP_003612834.1| Plastoglobulin-1 [Medicago truncatula] gi|35... 87 2e-15 gb|ACJ84215.1| unknown [Medicago truncatula] 87 2e-15 ref|XP_004244405.1| PREDICTED: plastid lipid-associated protein ... 87 2e-15 ref|XP_006367875.1| PREDICTED: plastoglobulin-1, chloroplastic-l... 87 3e-15 ref|XP_002297709.2| hypothetical protein POPTR_0001s02040g [Popu... 87 3e-15 ref|XP_007040679.1| Plastid-lipid associated protein PAP / fibri... 87 3e-15 >ref|XP_006432747.1| hypothetical protein CICLE_v10002003mg [Citrus clementina] gi|567880379|ref|XP_006432748.1| hypothetical protein CICLE_v10002003mg [Citrus clementina] gi|567880381|ref|XP_006432749.1| hypothetical protein CICLE_v10002003mg [Citrus clementina] gi|568834890|ref|XP_006471524.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like isoform X1 [Citrus sinensis] gi|568834892|ref|XP_006471525.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like isoform X2 [Citrus sinensis] gi|557534869|gb|ESR45987.1| hypothetical protein CICLE_v10002003mg [Citrus clementina] gi|557534870|gb|ESR45988.1| hypothetical protein CICLE_v10002003mg [Citrus clementina] gi|557534871|gb|ESR45989.1| hypothetical protein CICLE_v10002003mg [Citrus clementina] Length = 380 Score = 97.4 bits (241), Expect = 2e-18 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLKVPIPGERT+SWLLITYLD+DFRISRGDGGLFVLVKEGS LLD Sbjct: 331 SGQPPLKVPIPGERTQSWLLITYLDEDFRISRGDGGLFVLVKEGSPLLD 379 >gb|ABC96720.1| plastid fibrillin 2 [Coffea canephora] Length = 229 Score = 94.4 bits (233), Expect = 1e-17 Identities = 44/49 (89%), Positives = 45/49 (91%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLK+PIPGER KSWLLITYLDKD RISRGDGGLFVL KEGS LLD Sbjct: 180 SGQPPLKIPIPGERAKSWLLITYLDKDLRISRGDGGLFVLAKEGSTLLD 228 >ref|XP_006352897.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Solanum tuberosum] Length = 411 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELL 325 SGQPPLK+PIPGERTKSWLL TYLDKD RISRGDGGLFVLVKEGS LL Sbjct: 363 SGQPPLKIPIPGERTKSWLLTTYLDKDMRISRGDGGLFVLVKEGSSLL 410 >ref|XP_004148751.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like [Cucumis sativus] gi|449517090|ref|XP_004165579.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like [Cucumis sativus] Length = 363 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLK+PIPG+R KSWLLITYLD+D RISRGDGGLFVLVKEGS LLD Sbjct: 314 SGQPPLKIPIPGDRNKSWLLITYLDEDLRISRGDGGLFVLVKEGSALLD 362 >ref|XP_002518975.1| Plastid lipid-associated protein 3, chloroplast precursor, putative [Ricinus communis] gi|223541962|gb|EEF43508.1| Plastid lipid-associated protein 3, chloroplast precursor, putative [Ricinus communis] Length = 367 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLKVPIPG+R++SWLLITYLD+D RISRGDGGLFVLVKEGS LLD Sbjct: 319 SGQPPLKVPIPGDRSRSWLLITYLDEDLRISRGDGGLFVLVKEGSPLLD 367 >gb|EYU19055.1| hypothetical protein MIMGU_mgv1a026687mg, partial [Mimulus guttatus] Length = 168 Score = 92.4 bits (228), Expect = 6e-17 Identities = 44/49 (89%), Positives = 45/49 (91%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQP LK+PIPGE TKSWLL TYLDKDFRISRGDGGLFVLVKEGS LLD Sbjct: 119 SGQPSLKIPIPGEGTKSWLLTTYLDKDFRISRGDGGLFVLVKEGSPLLD 167 >emb|CBI33829.3| unnamed protein product [Vitis vinifera] Length = 273 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLKVPIPGER+ SWLLITYLDKD RISRGDGGLFVL +EGS LLD Sbjct: 223 SGQPPLKVPIPGERSSSWLLITYLDKDIRISRGDGGLFVLAREGSPLLD 271 >ref|XP_002276479.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like [Vitis vinifera] Length = 382 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLKVPIPGER+ SWLLITYLDKD RISRGDGGLFVL +EGS LLD Sbjct: 332 SGQPPLKVPIPGERSSSWLLITYLDKDIRISRGDGGLFVLAREGSPLLD 380 >gb|EXB66511.1| putative plastid-lipid-associated protein 3 [Morus notabilis] Length = 368 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELL 325 SGQPPL++PIPGERT+SWLLITYLD+DFRISRGDGGLFVL KEGS LL Sbjct: 319 SGQPPLRLPIPGERTQSWLLITYLDEDFRISRGDGGLFVLAKEGSPLL 366 >ref|XP_004512496.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Cicer arietinum] Length = 354 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLK+PIPGERT SWLL TYLDKD RISRGDGGLFVL +EGS LLD Sbjct: 305 SGQPPLKIPIPGERTSSWLLTTYLDKDLRISRGDGGLFVLAREGSPLLD 353 >ref|XP_004245973.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like [Solanum lycopersicum] Length = 344 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELL 325 SGQPPLK+PIPG RTKSWLL TYLDKD RISRGDGGLFVLVKEGS LL Sbjct: 296 SGQPPLKIPIPGGRTKSWLLTTYLDKDMRISRGDGGLFVLVKEGSSLL 343 >ref|XP_003516983.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Glycine max] Length = 370 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLK+PIPGERT SWLL TYLDKD RISRGDGGLFVL +EGS LLD Sbjct: 321 SGQPPLKIPIPGERTSSWLLTTYLDKDLRISRGDGGLFVLAREGSPLLD 369 >ref|XP_007158264.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris] gi|561031679|gb|ESW30258.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris] Length = 366 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLK+PIPGERT SWLL TYLD+D RISRGDGGLF+L +EGS LLD Sbjct: 317 SGQPPLKIPIPGERTSSWLLTTYLDQDLRISRGDGGLFILAREGSPLLD 365 >sp|Q9ZP40.1|PG1_PEA RecName: Full=Plastoglobulin-1, chloroplastic; Flags: Precursor gi|4105180|gb|AAD02288.1| plastoglobule associated protein PG1 precursor [Pisum sativum] Length = 358 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQ PLK+PIPGERT SWL+ TYLDKD RISRGDGGLFVL +EGS LLD Sbjct: 309 SGQSPLKIPIPGERTSSWLITTYLDKDLRISRGDGGLFVLAREGSSLLD 357 >ref|XP_003612834.1| Plastoglobulin-1 [Medicago truncatula] gi|355514169|gb|AES95792.1| Plastoglobulin-1 [Medicago truncatula] Length = 355 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQ PLK+PIPGERT SWLL TYLDKD RISRGDGGLFVL +EGS +LD Sbjct: 307 SGQSPLKIPIPGERTSSWLLTTYLDKDLRISRGDGGLFVLAREGSPILD 355 >gb|ACJ84215.1| unknown [Medicago truncatula] Length = 355 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQ PLK+PIPGERT SWLL TYLDKD RISRGDGGLFVL +EGS +LD Sbjct: 307 SGQSPLKIPIPGERTSSWLLTTYLDKDLRISRGDGGLFVLAREGSPILD 355 >ref|XP_004244405.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like [Solanum lycopersicum] Length = 418 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SG PPLKVPIPGERTKSWL+ TY+D D RISRGDGGLFVLVKE S LLD Sbjct: 369 SGLPPLKVPIPGERTKSWLITTYVDSDLRISRGDGGLFVLVKEESSLLD 417 >ref|XP_006367875.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Solanum tuberosum] Length = 204 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 S PPLKVPIPGERTKSWL+ TYLD D RISRGDGGLFVLVKE S LLD Sbjct: 156 SSMPPLKVPIPGERTKSWLITTYLDSDLRISRGDGGLFVLVKEQSSLLD 204 >ref|XP_002297709.2| hypothetical protein POPTR_0001s02040g [Populus trichocarpa] gi|550346271|gb|EEE82514.2| hypothetical protein POPTR_0001s02040g [Populus trichocarpa] Length = 349 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLKVPIPG++ SWLLITYLD+D RISRGDGGLFVL KEGS LL+ Sbjct: 300 SGQPPLKVPIPGKQASSWLLITYLDEDLRISRGDGGLFVLAKEGSPLLE 348 >ref|XP_007040679.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] gi|590679788|ref|XP_007040680.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] gi|508777924|gb|EOY25180.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] gi|508777925|gb|EOY25181.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] Length = 367 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -2 Query: 468 SGQPPLKVPIPGERTKSWLLITYLDKDFRISRGDGGLFVLVKEGSELLD 322 SGQPPLK+PIPGER+ SWLLITYLD+D RISRGDGGLFVL ++GS LL+ Sbjct: 318 SGQPPLKIPIPGERSGSWLLITYLDEDLRISRGDGGLFVLARQGSPLLE 366