BLASTX nr result
ID: Mentha23_contig00023448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00023448 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44775.1| hypothetical protein MIMGU_mgv11b013929mg [Mimulu... 64 3e-08 ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 61 1e-07 ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 60 2e-07 gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] 60 2e-07 ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [... 60 4e-07 gb|AFK48388.1| unknown [Lotus japonicus] 60 4e-07 ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 60 4e-07 ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arab... 60 4e-07 gb|ACU15919.1| unknown [Glycine max] 60 4e-07 gb|EYU35673.1| hypothetical protein MIMGU_mgv1a017603mg [Mimulus... 59 5e-07 gb|EYU20843.1| hypothetical protein MIMGU_mgv1a017612mg [Mimulus... 59 5e-07 sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subun... 59 7e-07 ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago tr... 59 7e-07 ref|XP_003625971.1| Cytochrome c oxidase subunit 5C [Medicago tr... 59 9e-07 ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [S... 58 1e-06 gb|ACG33529.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi... 58 1e-06 ref|XP_004962769.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 58 1e-06 ref|XP_006470279.1| PREDICTED: putative cytochrome c oxidase sub... 58 2e-06 ref|XP_006446555.1| hypothetical protein CICLE_v10017383mg [Citr... 58 2e-06 ref|XP_006292157.1| hypothetical protein CARUB_v10018363mg [Caps... 58 2e-06 >gb|EYU44775.1| hypothetical protein MIMGU_mgv11b013929mg [Mimulus guttatus] Length = 113 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WK HHW QR+T+EFYDLLDKGEITVVREDE Sbjct: 83 WKRHHWNNQRRTKEFYDLLDKGEITVVREDE 113 >ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] Length = 64 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR FYDLL+KGEITVV E++ Sbjct: 34 WKMHHWNEQRKTRTFYDLLEKGEITVVAEEQ 64 >ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Cicer arietinum] Length = 64 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR FYDLL+KGEI+V+ E+E Sbjct: 34 WKMHHWNEQRKTRTFYDLLEKGEISVIAEEE 64 >gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] Length = 77 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR FYD+LDKG+I+VV ED+ Sbjct: 34 WKMHHWNEQRKTRSFYDMLDKGQISVVVEDQ 64 >ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana] gi|48428152|sp|Q9FNE0.1|CX5C4_ARATH RecName: Full=Putative cytochrome c oxidase subunit 5C-4; AltName: Full=Cytochrome c oxidase polypeptide Vc-4 gi|10178149|dbj|BAB11594.1| cytochrome c oxidase Vc subunit [Arabidopsis thaliana] gi|332007158|gb|AED94541.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana] Length = 65 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW QR+T+EFYDLL+KGEI+VV EDE Sbjct: 35 WKMHHWNNQRRTKEFYDLLEKGEISVVVEDE 65 >gb|AFK48388.1| unknown [Lotus japonicus] Length = 64 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR FYDLL+KGEI VV E+E Sbjct: 34 WKMHHWNEQRKTRTFYDLLEKGEIGVVAEEE 64 >ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] Length = 64 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR FYDLL+KGEI+VV E++ Sbjct: 34 WKMHHWNEQRKTRTFYDLLEKGEISVVAEEQ 64 >ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. lyrata] gi|297314493|gb|EFH44916.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. lyrata] Length = 65 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW QR+T+EFYDLL+KGEI+VV EDE Sbjct: 35 WKMHHWNNQRRTKEFYDLLEKGEISVVVEDE 65 >gb|ACU15919.1| unknown [Glycine max] Length = 64 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR FYDLL+KGEI+VV E++ Sbjct: 34 WKMHHWNEQRKTRTFYDLLEKGEISVVAEEQ 64 >gb|EYU35673.1| hypothetical protein MIMGU_mgv1a017603mg [Mimulus guttatus] Length = 64 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRK R FYD+LDKGEITVV +E Sbjct: 34 WKMHHWNEQRKVRSFYDMLDKGEITVVAAEE 64 >gb|EYU20843.1| hypothetical protein MIMGU_mgv1a017612mg [Mimulus guttatus] Length = 64 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRK R FYD+LDKGEITVV +E Sbjct: 34 WKMHHWNEQRKVRSFYDMLDKGEITVVAAEE 64 >sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 gi|18409602|gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus] Length = 64 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR FYDLL+KGEI+VV ++E Sbjct: 34 WKMHHWNEQRKTRAFYDLLEKGEISVVVDEE 64 >ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] gi|355480448|gb|AES61651.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] Length = 64 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR FYDLL+KGEI+VV ++E Sbjct: 34 WKMHHWNEQRKTRTFYDLLEKGEISVVVDEE 64 >ref|XP_003625971.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] gi|355500986|gb|AES82189.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] gi|388519391|gb|AFK47757.1| unknown [Medicago truncatula] Length = 64 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR F+DLL+KGEI+V+ E+E Sbjct: 34 WKMHHWNEQRKTRTFHDLLEKGEISVIAEEE 64 >ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] gi|241944051|gb|EES17196.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] Length = 63 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVRED 324 WKMHHW EQRKTR FYD+LDKG+I+VV E+ Sbjct: 34 WKMHHWNEQRKTRSFYDMLDKGQISVVVEE 63 >gb|ACG33529.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195626174|gb|ACG34917.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195626710|gb|ACG35185.1| cytochrome c oxidase polypeptide Vc [Zea mays] Length = 62 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVRE 327 WKMHHW EQRKTR FYD+LDKG+I VV E Sbjct: 34 WKMHHWNEQRKTRSFYDMLDKGQIVVVEE 62 >ref|XP_004962769.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Setaria italica] gi|194693600|gb|ACF80884.1| unknown [Zea mays] gi|194705548|gb|ACF86858.1| unknown [Zea mays] gi|195605218|gb|ACG24439.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195608682|gb|ACG26171.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195610044|gb|ACG26852.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195618014|gb|ACG30837.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195655785|gb|ACG47360.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|414868438|tpg|DAA46995.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays] gi|414878119|tpg|DAA55250.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays] Length = 63 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVRED 324 WKMHHW EQRKTR FYD+LDKG+I+VV E+ Sbjct: 34 WKMHHWNEQRKTRSFYDMLDKGQISVVVEE 63 >ref|XP_006470279.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4-like [Citrus sinensis] Length = 64 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMH W QR+TREFYDLL+KGEI+VV EDE Sbjct: 34 WKMHQWNNQRRTREFYDLLEKGEISVVVEDE 64 >ref|XP_006446555.1| hypothetical protein CICLE_v10017383mg [Citrus clementina] gi|557549166|gb|ESR59795.1| hypothetical protein CICLE_v10017383mg [Citrus clementina] Length = 72 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMH W QR+TREFYDLL+KGEI+VV EDE Sbjct: 42 WKMHQWNNQRRTREFYDLLEKGEISVVVEDE 72 >ref|XP_006292157.1| hypothetical protein CARUB_v10018363mg [Capsella rubella] gi|482560864|gb|EOA25055.1| hypothetical protein CARUB_v10018363mg [Capsella rubella] Length = 64 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 413 WKMHHWKEQRKTREFYDLLDKGEITVVREDE 321 WKMHHW EQRKTR FYDLL++GEI+VV +E Sbjct: 34 WKMHHWNEQRKTRSFYDLLERGEISVVAAEE 64