BLASTX nr result
ID: Mentha23_contig00023358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00023358 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37440.1| hypothetical protein MIMGU_mgv11b003028mg [Mimulu... 67 3e-09 >gb|EYU37440.1| hypothetical protein MIMGU_mgv11b003028mg [Mimulus guttatus] Length = 571 Score = 66.6 bits (161), Expect = 3e-09 Identities = 38/70 (54%), Positives = 48/70 (68%), Gaps = 2/70 (2%) Frame = -1 Query: 353 GKREAEISTEEMDATPAKKVAIEAEFWRPNECD--SNAETIEGYLMIDGVWKKVEEEELH 180 GKREAEI T EMD T K++ I AE + D S E +G L+IDGVWKKV EEEL Sbjct: 502 GKREAEICTAEMDDTRVKRLEIVAEDCVMQDQDDVSEEEGTKGCLVIDGVWKKVGEEELS 561 Query: 179 AIASAVKLMI 150 AIASA+++++ Sbjct: 562 AIASAIRVLV 571