BLASTX nr result
ID: Mentha23_contig00023259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00023259 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43869.1| hypothetical protein MIMGU_mgv1a018596mg [Mimulus... 59 5e-07 >gb|EYU43869.1| hypothetical protein MIMGU_mgv1a018596mg [Mimulus guttatus] Length = 480 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 14 LNQLMIVCGASTAYIVGSVVTWRTLALTGL 103 LNQLMIVCGASTAY++G+VVTWRTLALTGL Sbjct: 174 LNQLMIVCGASTAYLLGTVVTWRTLALTGL 203