BLASTX nr result
ID: Mentha23_contig00023162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00023162 (663 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46533.1| hypothetical protein MIMGU_mgv1a002319mg [Mimulus... 58 3e-06 >gb|EYU46533.1| hypothetical protein MIMGU_mgv1a002319mg [Mimulus guttatus] Length = 688 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 663 FVRKYRTPSPGRSPDRSYRYSGRNVQRNQD 574 FVRKYRTPSP RSPDRSYR+ GRN QRN D Sbjct: 509 FVRKYRTPSPERSPDRSYRFGGRNTQRNND 538