BLASTX nr result
ID: Mentha23_contig00023062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00023062 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339534.1| PREDICTED: K(+) efflux antiporter 2, chlorop... 60 4e-07 ref|XP_004229880.1| PREDICTED: K(+) efflux antiporter 2, chlorop... 60 4e-07 gb|EYU32091.1| hypothetical protein MIMGU_mgv1a000390mg [Mimulus... 59 5e-07 ref|XP_003552379.2| PREDICTED: K(+) efflux antiporter 2, chlorop... 59 5e-07 ref|XP_007139897.1| hypothetical protein PHAVU_008G067800g [Phas... 59 5e-07 ref|XP_004492708.1| PREDICTED: K(+) efflux antiporter 2, chlorop... 59 5e-07 ref|XP_003623890.1| Glutathione-regulated potassium-efflux syste... 59 5e-07 ref|XP_007135028.1| hypothetical protein PHAVU_010G095800g [Phas... 59 7e-07 ref|XP_007135025.1| hypothetical protein PHAVU_010G095600g [Phas... 59 7e-07 ref|XP_006827715.1| hypothetical protein AMTR_s00009p00260060 [A... 59 7e-07 ref|XP_004306809.1| PREDICTED: LOW QUALITY PROTEIN: K(+) efflux ... 59 7e-07 ref|XP_002269352.1| PREDICTED: K(+) efflux antiporter 2, chlorop... 59 9e-07 ref|XP_006491056.1| PREDICTED: K(+) efflux antiporter 2, chlorop... 58 1e-06 ref|XP_006445095.1| hypothetical protein CICLE_v10018563mg [Citr... 58 1e-06 ref|XP_004510819.1| PREDICTED: K(+) efflux antiporter 2, chlorop... 58 1e-06 ref|XP_002987899.1| hypothetical protein SELMODRAFT_127003 [Sela... 58 1e-06 ref|XP_003534575.2| PREDICTED: K(+) efflux antiporter 2, chlorop... 58 2e-06 ref|XP_007220297.1| hypothetical protein PRUPE_ppa000383mg [Prun... 58 2e-06 ref|XP_006583328.1| PREDICTED: K(+) efflux antiporter 2, chlorop... 57 3e-06 ref|XP_002320781.2| hypothetical protein POPTR_0014s07660g [Popu... 57 3e-06 >ref|XP_006339534.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Solanum tuberosum] Length = 1201 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 +IN EEASLFDM WLLL SVIFVPIF KIPGGS Sbjct: 589 EINEEEASLFDMLWLLLASVIFVPIFQKIPGGS 621 >ref|XP_004229880.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Solanum lycopersicum] Length = 1198 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 +IN EEASLFDM WLLL SVIFVPIF KIPGGS Sbjct: 586 EINEEEASLFDMLWLLLASVIFVPIFQKIPGGS 618 >gb|EYU32091.1| hypothetical protein MIMGU_mgv1a000390mg [Mimulus guttatus] Length = 1193 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 +IN EEASLFDM WLLL SVIFVPIF KIPGGS Sbjct: 580 EINEEEASLFDMVWLLLASVIFVPIFQKIPGGS 612 >ref|XP_003552379.2| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Glycine max] Length = 1203 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SVIFVPIF KIPGGS Sbjct: 591 EVNEEEASLFDMLWLLLASVIFVPIFQKIPGGS 623 >ref|XP_007139897.1| hypothetical protein PHAVU_008G067800g [Phaseolus vulgaris] gi|593332945|ref|XP_007139898.1| hypothetical protein PHAVU_008G067800g [Phaseolus vulgaris] gi|561013030|gb|ESW11891.1| hypothetical protein PHAVU_008G067800g [Phaseolus vulgaris] gi|561013031|gb|ESW11892.1| hypothetical protein PHAVU_008G067800g [Phaseolus vulgaris] Length = 1192 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SVIFVPIF KIPGGS Sbjct: 580 EVNEEEASLFDMLWLLLASVIFVPIFQKIPGGS 612 >ref|XP_004492708.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Cicer arietinum] Length = 1197 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SVIFVPIF KIPGGS Sbjct: 583 EVNEEEASLFDMLWLLLASVIFVPIFQKIPGGS 615 >ref|XP_003623890.1| Glutathione-regulated potassium-efflux system protein [Medicago truncatula] gi|355498905|gb|AES80108.1| Glutathione-regulated potassium-efflux system protein [Medicago truncatula] Length = 1233 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SVIFVPIF KIPGGS Sbjct: 579 EVNEEEASLFDMLWLLLASVIFVPIFQKIPGGS 611 >ref|XP_007135028.1| hypothetical protein PHAVU_010G095800g [Phaseolus vulgaris] gi|561008073|gb|ESW07022.1| hypothetical protein PHAVU_010G095800g [Phaseolus vulgaris] Length = 1032 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SV+FVPIF KIPGGS Sbjct: 572 EVNEEEASLFDMLWLLLASVVFVPIFQKIPGGS 604 >ref|XP_007135025.1| hypothetical protein PHAVU_010G095600g [Phaseolus vulgaris] gi|561008070|gb|ESW07019.1| hypothetical protein PHAVU_010G095600g [Phaseolus vulgaris] Length = 1188 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SV+FVPIF KIPGGS Sbjct: 585 EVNEEEASLFDMLWLLLASVVFVPIFQKIPGGS 617 >ref|XP_006827715.1| hypothetical protein AMTR_s00009p00260060 [Amborella trichopoda] gi|548832335|gb|ERM95131.1| hypothetical protein AMTR_s00009p00260060 [Amborella trichopoda] Length = 1081 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 +IN EEASLFDM WLLL SVIFVP+F KIPGGS Sbjct: 470 EINEEEASLFDMLWLLLASVIFVPLFQKIPGGS 502 >ref|XP_004306809.1| PREDICTED: LOW QUALITY PROTEIN: K(+) efflux antiporter 2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 1225 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SVIFVP+F KIPGGS Sbjct: 613 EVNEEEASLFDMLWLLLASVIFVPVFQKIPGGS 645 >ref|XP_002269352.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Vitis vinifera] Length = 1207 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SVIFVPIF KIPGGS Sbjct: 595 EMNEEEASLFDMLWLLLASVIFVPIFQKIPGGS 627 >ref|XP_006491056.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Citrus sinensis] Length = 1207 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 +IN EEASLFD+ WLLL SVIFVPIF KIPGGS Sbjct: 595 EINEEEASLFDVLWLLLASVIFVPIFQKIPGGS 627 >ref|XP_006445095.1| hypothetical protein CICLE_v10018563mg [Citrus clementina] gi|557547357|gb|ESR58335.1| hypothetical protein CICLE_v10018563mg [Citrus clementina] Length = 1194 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 +IN EEASLFD+ WLLL SVIFVPIF KIPGGS Sbjct: 582 EINEEEASLFDVLWLLLASVIFVPIFQKIPGGS 614 >ref|XP_004510819.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Cicer arietinum] Length = 1167 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SVIFVP+F KIPGGS Sbjct: 557 EVNDEEASLFDMLWLLLASVIFVPLFQKIPGGS 589 >ref|XP_002987899.1| hypothetical protein SELMODRAFT_127003 [Selaginella moellendorffii] gi|302819253|ref|XP_002991297.1| hypothetical protein SELMODRAFT_133365 [Selaginella moellendorffii] gi|300140877|gb|EFJ07595.1| hypothetical protein SELMODRAFT_133365 [Selaginella moellendorffii] gi|300144288|gb|EFJ10973.1| hypothetical protein SELMODRAFT_127003 [Selaginella moellendorffii] Length = 626 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 Q+N EEASLFD+ WLLL SV+FVP+F KIPGGS Sbjct: 8 QVNEEEASLFDVLWLLLASVVFVPVFQKIPGGS 40 >ref|XP_003534575.2| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like isoform X1 [Glycine max] gi|571479436|ref|XP_006587859.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like isoform X2 [Glycine max] Length = 1202 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFD+ WLLL SVIFVPIF KIPGGS Sbjct: 590 EVNEEEASLFDILWLLLASVIFVPIFQKIPGGS 622 >ref|XP_007220297.1| hypothetical protein PRUPE_ppa000383mg [Prunus persica] gi|462416759|gb|EMJ21496.1| hypothetical protein PRUPE_ppa000383mg [Prunus persica] Length = 1223 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFDM WLLL SVIFVP+F +IPGGS Sbjct: 611 EVNEEEASLFDMLWLLLASVIFVPVFQRIPGGS 643 >ref|XP_006583328.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like isoform X2 [Glycine max] Length = 1004 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 +++ EEASLFDM WLLL SV+FVPIF KIPGGS Sbjct: 594 EVDEEEASLFDMLWLLLASVVFVPIFQKIPGGS 626 >ref|XP_002320781.2| hypothetical protein POPTR_0014s07660g [Populus trichocarpa] gi|550323727|gb|EEE99096.2| hypothetical protein POPTR_0014s07660g [Populus trichocarpa] Length = 1215 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 158 QINVEEASLFDMFWLLLVSVIFVPIFNKIPGGS 60 ++N EEASLFD+ WLLL SVIFVPIF KIPGGS Sbjct: 603 EMNEEEASLFDVLWLLLASVIFVPIFQKIPGGS 635