BLASTX nr result
ID: Mentha23_contig00022987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022987 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350536.1| PREDICTED: soluble starch synthase 1, chloro... 57 2e-06 ref|XP_004234971.1| PREDICTED: soluble starch synthase 1, chloro... 57 2e-06 ref|NP_001275074.1| soluble starch synthase 1, chloroplastic/amy... 57 2e-06 >ref|XP_006350536.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic-like isoform X2 [Solanum tuberosum] Length = 641 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 4/71 (5%) Frame = +2 Query: 119 IESRVVDCLSGVKQVG--FAPLLSGKR--KGRSLCVKARLYKEDKNAQNKETEEGVLLGT 286 + RVV L +QVG F+ LL G+R K +SLCV + + A+NK+ EG+LLG Sbjct: 18 VSGRVVRGLRVERQVGLGFSWLLKGRRNRKVQSLCVTSSVSDGSSIAENKKVSEGLLLGA 77 Query: 287 ERDGTGSVVGF 319 ERDG+GSVVGF Sbjct: 78 ERDGSGSVVGF 88 >ref|XP_004234971.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic-like [Solanum lycopersicum] Length = 641 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 4/71 (5%) Frame = +2 Query: 119 IESRVVDCLSGVKQVG--FAPLLSGKR--KGRSLCVKARLYKEDKNAQNKETEEGVLLGT 286 + RVV L +QVG F+ LL G+R K +SLCV + + A+NK+ EG+LLG Sbjct: 18 VSGRVVKGLRVERQVGLGFSWLLKGRRNRKVQSLCVTSSVSDGSSIAENKKVSEGLLLGP 77 Query: 287 ERDGTGSVVGF 319 ERDG+GSVVGF Sbjct: 78 ERDGSGSVVGF 88 >ref|NP_001275074.1| soluble starch synthase 1, chloroplastic/amyloplastic [Solanum tuberosum] gi|2829792|sp|P93568.1|SSY1_SOLTU RecName: Full=Soluble starch synthase 1, chloroplastic/amyloplastic; AltName: Full=Soluble starch synthase I; Short=SS I; Flags: Precursor gi|1781353|emb|CAA71442.1| soluble starch (bacterial glycogen) synthase [Solanum tuberosum] Length = 641 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 4/71 (5%) Frame = +2 Query: 119 IESRVVDCLSGVKQVG--FAPLLSGKR--KGRSLCVKARLYKEDKNAQNKETEEGVLLGT 286 + RVV L +QVG F+ LL G+R K +SLCV + + A+NK EG+LLG Sbjct: 18 VSGRVVKGLRVERQVGLGFSWLLKGRRNRKVQSLCVTSSVSDGSSIAENKNVSEGLLLGA 77 Query: 287 ERDGTGSVVGF 319 ERDG+GSVVGF Sbjct: 78 ERDGSGSVVGF 88