BLASTX nr result
ID: Mentha23_contig00022958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022958 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27528.1| hypothetical protein MIMGU_mgv1a007002mg [Mimulus... 66 4e-11 gb|EXB42558.1| DNA repair protein recA-1-like protein [Morus not... 64 2e-08 emb|CBI21810.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002271727.1| PREDICTED: DNA repair protein recA homolog 1... 62 6e-08 ref|XP_007215528.1| hypothetical protein PRUPE_ppa007080mg [Prun... 60 2e-07 ref|XP_006346054.1| PREDICTED: DNA repair protein recA homolog 1... 59 9e-07 ref|XP_007133319.1| hypothetical protein PHAVU_011G169700g [Phas... 57 2e-06 ref|XP_003546633.1| PREDICTED: DNA repair protein recA homolog 1... 57 2e-06 ref|XP_004243994.1| PREDICTED: DNA repair protein recA homolog 1... 57 3e-06 ref|XP_006301561.1| hypothetical protein CARUB_v10021995mg [Caps... 56 5e-06 gb|AAA32855.1| replicase, partial [Arabidopsis thaliana] 56 6e-06 ref|NP_565198.1| DNA repair protein recA-like 1 [Arabidopsis tha... 56 6e-06 dbj|BAH56931.1| AT1G79050 [Arabidopsis thaliana] 56 6e-06 ref|NP_001077844.1| DNA repair protein recA-like 1 [Arabidopsis ... 56 6e-06 ref|XP_004151803.1| PREDICTED: DNA repair protein recA homolog 1... 55 8e-06 ref|XP_004151021.1| PREDICTED: DNA repair protein recA homolog 1... 55 8e-06 >gb|EYU27528.1| hypothetical protein MIMGU_mgv1a007002mg [Mimulus guttatus] Length = 423 Score = 65.9 bits (159), Expect(2) = 4e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -2 Query: 115 KNVRVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 K +RVRSEFD K+NGALSADFD RF+DRQKAL+AAMND Sbjct: 46 KLIRVRSEFDGKVNGALSADFDSRFVDRQKALDAAMND 83 Score = 27.3 bits (59), Expect(2) = 4e-11 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 227 MDLVFPLRTRYASPKPRNCSSATAPAPSS 141 MDL FPL+T+ S K + CSS SS Sbjct: 1 MDLTFPLKTQCLSSKFKYCSSPAFSNASS 29 >gb|EXB42558.1| DNA repair protein recA-1-like protein [Morus notabilis] Length = 438 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 106 RVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 R+R EFDAK+NGAL +FDPRFLDRQKALEAAMND Sbjct: 54 RIRCEFDAKINGALPGEFDPRFLDRQKALEAAMND 88 >emb|CBI21810.3| unnamed protein product [Vitis vinifera] Length = 384 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 118 RKNVRVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 R+ +R+R EF+ K+NGALS+D DPRFLDRQKALEAAMND Sbjct: 5 RQQMRLRCEFEVKVNGALSSDPDPRFLDRQKALEAAMND 43 >ref|XP_002271727.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like [Vitis vinifera] Length = 415 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 118 RKNVRVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 R+ +R+R EF+ K+NGALS+D DPRFLDRQKALEAAMND Sbjct: 36 RQQMRLRCEFEVKVNGALSSDPDPRFLDRQKALEAAMND 74 >ref|XP_007215528.1| hypothetical protein PRUPE_ppa007080mg [Prunus persica] gi|462411678|gb|EMJ16727.1| hypothetical protein PRUPE_ppa007080mg [Prunus persica] Length = 383 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 106 RVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 RVR E AK+NGALSAD DPRF+DRQKALEAAMND Sbjct: 8 RVRCELQAKVNGALSADSDPRFIDRQKALEAAMND 42 >ref|XP_006346054.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like [Solanum tuberosum] Length = 419 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 115 KNVRVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 + +RVRSEFD K+NG S D D RFLDRQKAL+AAMND Sbjct: 41 RGIRVRSEFDHKINGTFSPDSDARFLDRQKALDAAMND 78 >ref|XP_007133319.1| hypothetical protein PHAVU_011G169700g [Phaseolus vulgaris] gi|561006319|gb|ESW05313.1| hypothetical protein PHAVU_011G169700g [Phaseolus vulgaris] Length = 415 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 115 KNVRVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 K+ ++ E + + NGALS DFDPRF+DRQKALEAAMND Sbjct: 37 KHANIQCELEGRPNGALSGDFDPRFIDRQKALEAAMND 74 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 227 MDLVFPLRTRYASPKPRNCSSATAPAP 147 MDL+FPL+ K SS P P Sbjct: 1 MDLMFPLKPHSVILKAPLFSSLLFPLP 27 >ref|XP_003546633.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like [Glycine max] Length = 414 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 115 KNVRVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 K+ ++ E + + NGALS DFDPRF+DRQKALEAAMND Sbjct: 37 KHANIQCELEGRPNGALSGDFDPRFIDRQKALEAAMND 74 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 227 MDLVFPLRTRYASPKPRNCSSATAPAP 147 MDL+FPL+ K SS P P Sbjct: 1 MDLMFPLKPHCVILKAPLSSSLLFPFP 27 >ref|XP_004243994.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like [Solanum lycopersicum] Length = 419 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 109 VRVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 +RVRSEFD K+NGA S D D R LDRQKAL+AAMND Sbjct: 43 IRVRSEFDHKINGAFSPDSDARILDRQKALDAAMND 78 >ref|XP_006301561.1| hypothetical protein CARUB_v10021995mg [Capsella rubella] gi|482570271|gb|EOA34459.1| hypothetical protein CARUB_v10021995mg [Capsella rubella] Length = 434 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 112 NVRVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 N + SEFD ++NGALS D D RFLDRQKALEAAMND Sbjct: 53 NHNISSEFDDRINGALSPDADSRFLDRQKALEAAMND 89 >gb|AAA32855.1| replicase, partial [Arabidopsis thaliana] Length = 438 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 106 RVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 ++ SEFD ++NGALS D D RFLDRQKALEAAMND Sbjct: 58 KISSEFDDRINGALSPDADSRFLDRQKALEAAMND 92 >ref|NP_565198.1| DNA repair protein recA-like 1 [Arabidopsis thaliana] gi|2500098|sp|Q39199.1|RECAC_ARATH RecName: Full=DNA repair protein recA homolog 1, chloroplastic; AltName: Full=Recombinase A homolog 1; Flags: Precursor gi|289208|gb|AAA61781.1| chloroplast DNA repair protein precursor [Arabidopsis thaliana] gi|3152570|gb|AAC17051.1| Match to nuclear-encoded chloroplast DNA repair protein (E. coli recA homolog) gb|L15229 [Arabidopsis thaliana] gi|15292903|gb|AAK92822.1| putative replicase [Arabidopsis thaliana] gi|21281181|gb|AAM45008.1| putative replicase [Arabidopsis thaliana] gi|332198076|gb|AEE36197.1| DNA repair protein recA-like 1 [Arabidopsis thaliana] Length = 439 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 106 RVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 ++ SEFD ++NGALS D D RFLDRQKALEAAMND Sbjct: 59 KISSEFDDRINGALSPDADSRFLDRQKALEAAMND 93 >dbj|BAH56931.1| AT1G79050 [Arabidopsis thaliana] Length = 448 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 106 RVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 ++ SEFD ++NGALS D D RFLDRQKALEAAMND Sbjct: 59 KISSEFDDRINGALSPDADSRFLDRQKALEAAMND 93 >ref|NP_001077844.1| DNA repair protein recA-like 1 [Arabidopsis thaliana] gi|332198077|gb|AEE36198.1| DNA repair protein recA-like 1 [Arabidopsis thaliana] Length = 343 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 106 RVRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 ++ SEFD ++NGALS D D RFLDRQKALEAAMND Sbjct: 59 KISSEFDDRINGALSPDADSRFLDRQKALEAAMND 93 >ref|XP_004151803.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like, partial [Cucumis sativus] Length = 125 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/39 (71%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -2 Query: 115 KNVR-VRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 K VR +R EF+ LNGALS DFDPR +DR+KALEAAMND Sbjct: 41 KRVRELRCEFEVNLNGALSGDFDPRSVDRKKALEAAMND 79 >ref|XP_004151021.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like [Cucumis sativus] Length = 417 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/39 (71%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -2 Query: 115 KNVR-VRSEFDAKLNGALSADFDPRFLDRQKALEAAMND 2 K VR +R EF+ LNGALS DFDPR +DR+KALEAAMND Sbjct: 41 KRVRELRCEFEVNLNGALSGDFDPRSVDRKKALEAAMND 79