BLASTX nr result
ID: Mentha23_contig00022842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022842 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33580.1| hypothetical protein MIMGU_mgv1a010110mg [Mimulus... 61 2e-07 >gb|EYU33580.1| hypothetical protein MIMGU_mgv1a010110mg [Mimulus guttatus] Length = 322 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 312 FGVKDANELLVNSDGSARVSADAMMQASFMGLAVMAILVILLKRA 178 FG K N + +NSDG+A +SA+ +MQ SFMGLA+MAILVILLKRA Sbjct: 278 FGGKGGNGVTLNSDGTANLSAETVMQGSFMGLAIMAILVILLKRA 322