BLASTX nr result
ID: Mentha23_contig00022728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022728 (1960 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007026766.1| Major facilitator superfamily protein, putat... 60 4e-06 >ref|XP_007026766.1| Major facilitator superfamily protein, putative [Theobroma cacao] gi|508715371|gb|EOY07268.1| Major facilitator superfamily protein, putative [Theobroma cacao] Length = 630 Score = 60.1 bits (144), Expect = 4e-06 Identities = 28/75 (37%), Positives = 48/75 (64%) Frame = +2 Query: 467 IAGLVFSYMLVEKAFLDILMTILRRAWKVHNLQKAVIVVNLQEGTSAVLGIFFAFFAGVY 646 I+GLVFS+ L E A + IL + WK +L++A VVN++EG S ++ I ++ + Y Sbjct: 80 ISGLVFSHGLAEHAVMCILTSYFMENWKKTDLRQAAAVVNVEEGASTIMAIIVSYISDAY 139 Query: 647 TGRYVMVLISTGVCI 691 R+ +++ +TG+CI Sbjct: 140 FCRFKVIVHTTGLCI 154