BLASTX nr result
ID: Mentha23_contig00022514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022514 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230478.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 62 1e-07 ref|XP_004230477.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 62 1e-07 ref|XP_006349360.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 61 2e-07 >ref|XP_004230478.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like isoform 2 [Solanum lycopersicum] Length = 208 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = +1 Query: 196 FPATCVLHVWRYMAKFKQCVCPICGCLIFNLVSHPSALVQPGEDAAKILSEISRYN 363 F A C+L +W Y + ++C CPIC CLI LV S LVQ +D ++L +I RYN Sbjct: 41 FCANCILQLWYYRSTLRRCKCPICSCLISKLVPEASLLVQQEKDVVELLKKIRRYN 96 >ref|XP_004230477.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like isoform 1 [Solanum lycopersicum] Length = 227 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = +1 Query: 196 FPATCVLHVWRYMAKFKQCVCPICGCLIFNLVSHPSALVQPGEDAAKILSEISRYN 363 F A C+L +W Y + ++C CPIC CLI LV S LVQ +D ++L +I RYN Sbjct: 60 FCANCILQLWYYRSTLRRCKCPICSCLISKLVPEASLLVQQEKDVVELLKKIRRYN 115 >ref|XP_006349360.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Solanum tuberosum] Length = 226 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = +1 Query: 196 FPATCVLHVWRYMAKFKQCVCPICGCLIFNLVSHPSALVQPGEDAAKILSEISRYN 363 F A+C+L +W Y + ++C CPIC CLI LV S L Q ED ++L +I RYN Sbjct: 59 FCASCILQLWYYRSTLRRCKCPICCCLISKLVPEASLLAQQEEDVVELLKKIRRYN 114