BLASTX nr result
ID: Mentha23_contig00022504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022504 (608 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23002.1| hypothetical protein MIMGU_mgv11b017482mg [Mimulu... 51 4e-08 >gb|EYU23002.1| hypothetical protein MIMGU_mgv11b017482mg [Mimulus guttatus] Length = 248 Score = 50.8 bits (120), Expect(2) = 4e-08 Identities = 25/56 (44%), Positives = 34/56 (60%) Frame = -1 Query: 170 LQALDQPYAVGCLAKGIASLRNKCIDLRYFVDXXXXXXXXXXXGRTFRTGNHETTP 3 + LDQP+AVGCL KG+AS R + ++ Y+VD GR FR+G+ E TP Sbjct: 84 ITTLDQPFAVGCLEKGLASFRKQSMEHVYYVDERAKDEQVGPPGRVFRSGSPEFTP 139 Score = 32.7 bits (73), Expect(2) = 4e-08 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -2 Query: 283 VRERIEDSMKRVIAAEVRENWIVQFWAPKVVEGRCCL 173 + ++I M ++I E + +VQFWAPK E RCC+ Sbjct: 49 LEDKITYFMSQIIHKESSYS-LVQFWAPKFEENRCCI 84