BLASTX nr result
ID: Mentha23_contig00022348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022348 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32110.1| hypothetical protein MIMGU_mgv1a007916mg [Mimulus... 64 2e-08 >gb|EYU32110.1| hypothetical protein MIMGU_mgv1a007916mg [Mimulus guttatus] Length = 391 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/68 (52%), Positives = 44/68 (64%) Frame = -1 Query: 218 MYAQTLPIRIPNHISHDPPINRFHILAFSQNSRLGFCNSSKRATETKTISRNSSRMAAIR 39 MYAQTLP HI H+PP R I AF NS+LGF NS+KR + + SR S+ +A I Sbjct: 1 MYAQTLPFS--KHIIHNPPTKR-QIPAFPPNSQLGFSNSAKRVSVSGISSRKSAHLAMIV 57 Query: 38 CGGSQEMQ 15 CGGSQ+ Q Sbjct: 58 CGGSQDKQ 65