BLASTX nr result
ID: Mentha23_contig00022347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022347 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32110.1| hypothetical protein MIMGU_mgv1a007916mg [Mimulus... 62 8e-08 >gb|EYU32110.1| hypothetical protein MIMGU_mgv1a007916mg [Mimulus guttatus] Length = 391 Score = 62.0 bits (149), Expect = 8e-08 Identities = 36/68 (52%), Positives = 42/68 (61%) Frame = -3 Query: 219 MYAQTLPIRIPNHISHNPPVNRFHNLAFSQNPRLGFCNSSKRVAETKTSSGNSSRMAAIR 40 MYAQTLP HI HNPP R AF N +LGF NS+KRV+ + SS S+ +A I Sbjct: 1 MYAQTLPFS--KHIIHNPPTKR-QIPAFPPNSQLGFSNSAKRVSVSGISSRKSAHLAMIV 57 Query: 39 CGGSQGMQ 16 CGGSQ Q Sbjct: 58 CGGSQDKQ 65