BLASTX nr result
ID: Mentha23_contig00022195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022195 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32233.1| hypothetical protein MIMGU_mgv1a004674mg [Mimulus... 74 3e-11 gb|AAW80627.1| autophagy protein beclin1 [Nicotiana benthamiana] 59 7e-07 emb|CAJ27520.1| beclin 1 protein [Gossypium raimondii] 56 6e-06 >gb|EYU32233.1| hypothetical protein MIMGU_mgv1a004674mg [Mimulus guttatus] Length = 515 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 186 MKRNGSTSNVSDKGRMLAVDPNLPRFLCQNCRQSLCVVGID 308 M++NGS SNV+DKGR+L DPNLPRFLCQNCRQSLC+ G+D Sbjct: 1 MRKNGSGSNVADKGRILPADPNLPRFLCQNCRQSLCMSGVD 41 >gb|AAW80627.1| autophagy protein beclin1 [Nicotiana benthamiana] Length = 527 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/39 (66%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +3 Query: 195 NGSTSNVS-DKGRMLAVDPNLPRFLCQNCRQSLCVVGID 308 + ST+N++ DKGR L VDPNLPR+LCQNC LCVVG+D Sbjct: 6 SSSTNNLTPDKGRTLPVDPNLPRYLCQNCHNPLCVVGVD 44 >emb|CAJ27520.1| beclin 1 protein [Gossypium raimondii] Length = 511 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +3 Query: 213 VSDKGRMLAVDPNLPRFLCQNCRQSLCVVGID 308 + DKGR L VDPNLP+++CQNC SLC+VG+D Sbjct: 6 IPDKGRSLPVDPNLPKWICQNCHHSLCIVGVD 37