BLASTX nr result
ID: Mentha23_contig00022115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00022115 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17646.1| hypothetical protein MIMGU_mgv1a006944mg [Mimulus... 59 5e-07 >gb|EYU17646.1| hypothetical protein MIMGU_mgv1a006944mg [Mimulus guttatus] Length = 425 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/82 (42%), Positives = 56/82 (68%), Gaps = 2/82 (2%) Frame = -1 Query: 315 VSLKKLGFPSRNEASL*REQASLRFA-PNIPCNNPFKKQTKDDELLLNQA-MTTDEHASE 142 ++L+KL FP RNEAS +++ FA NIP NNPFKK+ +++ L+ + + DE AS+ Sbjct: 307 IALEKLAFPLRNEASKKKKKVPTSFASSNIPNNNPFKKRKQNEIQLIREVDVDVDEEASQ 366 Query: 141 VTEIDVRILVINSDIRKNIDSK 76 VTEI+ +V +D ++++DSK Sbjct: 367 VTEIENSRIV--TDSQESVDSK 386