BLASTX nr result
ID: Mentha23_contig00021883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00021883 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31140.1| hypothetical protein MIMGU_mgv1a000697mg [Mimulus... 67 2e-09 >gb|EYU31140.1| hypothetical protein MIMGU_mgv1a000697mg [Mimulus guttatus] Length = 1015 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 342 FLVAKLVSSMEHGQTHHKEMFGLNFTPRRSTRSHHSFRKSLISFL 208 FLVAK+V S+E G+TH+KEMFGLNFTPRRSTRS+ + + SLIS L Sbjct: 971 FLVAKVVGSIEPGKTHNKEMFGLNFTPRRSTRSYSTLKHSLISLL 1015