BLASTX nr result
ID: Mentha23_contig00021735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00021735 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34600.1| hypothetical protein MIMGU_mgv1a020103mg [Mimulus... 65 1e-08 >gb|EYU34600.1| hypothetical protein MIMGU_mgv1a020103mg [Mimulus guttatus] Length = 370 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = +2 Query: 2 SGPCEPEDKRKIPLDGRPNVQFKFGNVKKSLSMVTIFQNNGTERTSPWFGDDHDGDGAEE 181 + PCE ED+R I + R NV FKFGN KKS+ Q G+E+ S WFGDD DG+ +E Sbjct: 297 NAPCETEDRRNILFNERQNVHFKFGNSKKSVGTGMCSQTEGSEKNSLWFGDDCDGE--DE 354 Query: 182 KK 187 KK Sbjct: 355 KK 356