BLASTX nr result
ID: Mentha23_contig00021606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00021606 (563 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43120.1| hypothetical protein MIMGU_mgv1a003739mg [Mimulus... 63 6e-08 >gb|EYU43120.1| hypothetical protein MIMGU_mgv1a003739mg [Mimulus guttatus] Length = 567 Score = 62.8 bits (151), Expect = 6e-08 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 2/73 (2%) Frame = +1 Query: 148 NAPAEGNAIMSEDPTSNWFSDMSSPSLESGLSAKN--EDAIQSSEDHVKMLISQMHDLSF 321 N E N+I+ E P NW SD + +AKN + + +S++D V MLISQMHDLSF Sbjct: 496 NVLTEANSIVPEIP--NWLSDGNE-------AAKNVVDASEKSTKDEVMMLISQMHDLSF 546 Query: 322 MLDTDLSIPSGSD 360 MLDT+LSIP+GSD Sbjct: 547 MLDTNLSIPTGSD 559