BLASTX nr result
ID: Mentha23_contig00021452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00021452 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23400.1| hypothetical protein MIMGU_mgv1a004206mg [Mimulus... 76 4e-12 >gb|EYU23400.1| hypothetical protein MIMGU_mgv1a004206mg [Mimulus guttatus] Length = 539 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -3 Query: 441 HQNVGSNPPSSGKVPEGRVHGGNLMAMLAGAPSFDFPRGKPAVDTLDTEKSFMTHQSWM 265 H GSN SSGKVPEGRVHGGNLMA+LAG P F+FP G A + + EKSF+THQ+WM Sbjct: 483 HMPSGSNR-SSGKVPEGRVHGGNLMALLAGGPGFNFPSGDMAGPS-EPEKSFVTHQTWM 539