BLASTX nr result
ID: Mentha23_contig00021214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00021214 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36458.1| hypothetical protein MIMGU_mgv1a008630mg [Mimulus... 86 5e-15 >gb|EYU36458.1| hypothetical protein MIMGU_mgv1a008630mg [Mimulus guttatus] Length = 367 Score = 85.9 bits (211), Expect = 5e-15 Identities = 47/104 (45%), Positives = 61/104 (58%) Frame = -3 Query: 328 GLLDSKSEECRSGSPEDLNTTHAFEDDIQFTVKSNPLGGFHESSLCQVGQGIEMTLLPTI 149 GLLD++SE NTT + + +VK PL E+S C GQGIEMTLLP Sbjct: 80 GLLDTQSEVP--------NTTDVHQSGVDLSVKPGPLSYCLENSPCHTGQGIEMTLLPAS 131 Query: 148 STRSTQCTDTSGLVLKELFKQGSVPESFADESWGSLENRASILE 17 S +T+CT TSGL+ +L+KQ S E F D W +LE+R S+ E Sbjct: 132 SIENTRCTKTSGLIFNDLYKQPSTSEPFNDTPWEALESRPSLNE 175