BLASTX nr result
ID: Mentha23_contig00021190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00021190 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38411.1| hypothetical protein MIMGU_mgv1a021572mg [Mimulus... 68 1e-09 gb|EYU44044.1| hypothetical protein MIMGU_mgv1a017183mg [Mimulus... 57 3e-06 >gb|EYU38411.1| hypothetical protein MIMGU_mgv1a021572mg [Mimulus guttatus] Length = 99 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/43 (72%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = +3 Query: 186 MSGWTGAT---VFRWLDVSLALPTSLFRWPRLVTSYLTPPPRW 305 MS WT A + RWLDVS +LPTS FRWPRL TSYLTPPPRW Sbjct: 1 MSRWTAAPPPPLSRWLDVSFSLPTSFFRWPRLFTSYLTPPPRW 43 >gb|EYU44044.1| hypothetical protein MIMGU_mgv1a017183mg [Mimulus guttatus] Length = 89 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +3 Query: 186 MSGWTGATVFRWLDVSLALPTSLFRWPRLVTSYLTPPPRW 305 M+ WT A FRWL+ S++L SLFRWP L SYLTPPP W Sbjct: 1 MAQWTSA--FRWLEASISLSASLFRWPPLFVSYLTPPPIW 38