BLASTX nr result
ID: Mentha23_contig00020998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00020998 (541 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus... 119 5e-25 gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] 116 3e-24 ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containi... 115 7e-24 emb|CBI24015.3| unnamed protein product [Vitis vinifera] 114 1e-23 ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prun... 114 2e-23 gb|EXB44248.1| hypothetical protein L484_001646 [Morus notabilis] 113 3e-23 gb|EPS69231.1| hypothetical protein M569_05535 [Genlisea aurea] 110 2e-22 ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily pr... 110 2e-22 ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|NP_196272.1| pentatricopeptide repeat-containing protein [Ar... 110 3e-22 ref|XP_004253185.1| PREDICTED: pentatricopeptide repeat-containi... 109 4e-22 ref|XP_007154464.1| hypothetical protein PHAVU_003G121400g [Phas... 109 5e-22 ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containi... 109 5e-22 ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 gb|EMT27117.1| hypothetical protein F775_08942 [Aegilops tauschii] 107 2e-21 ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_003541335.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_002873264.1| pentatricopeptide repeat-containing protein ... 106 3e-21 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 106 4e-21 >gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus guttatus] Length = 621 Score = 119 bits (298), Expect = 5e-25 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+KTK GETIRVTKNLRVC+DCH ASKLIS YDREI+VRDRNRFHHFRGG+CSCNDYW Sbjct: 562 GLLKTKAGETIRVTKNLRVCRDCHVASKLISMVYDREIVVRDRNRFHHFRGGLCSCNDYW 621 >gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] Length = 542 Score = 116 bits (291), Expect = 3e-24 Identities = 51/78 (65%), Positives = 64/78 (82%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL++T+PG+T+RVTKNLRVC+DCHEA+KLIS ++REI+VRDRNRFHHFR G CSCNDYW Sbjct: 374 GLLRTRPGDTMRVTKNLRVCRDCHEATKLISRVFEREIVVRDRNRFHHFRDGACSCNDYW 433 Query: 181 *KLSGSEILYFGTKLFCR 234 K + FG L+C+ Sbjct: 434 GKGGMNSTKEFG--LYCK 449 >ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 628 Score = 115 bits (288), Expect = 7e-24 Identities = 48/60 (80%), Positives = 55/60 (91%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+K+KPGE +R+TKNLRVCKDCH+ASK IS+ YDREIIVRDRNRFHHF+GG CSC DYW Sbjct: 569 GLLKSKPGEILRITKNLRVCKDCHQASKFISKVYDREIIVRDRNRFHHFKGGECSCKDYW 628 >emb|CBI24015.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 114 bits (286), Expect = 1e-23 Identities = 47/60 (78%), Positives = 56/60 (93%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+KTKPGET+R++KNLR+C+DCH+ASKLIS+ YDREII+RDRNRFHHFR G CSC DYW Sbjct: 510 GLLKTKPGETLRISKNLRICRDCHQASKLISKVYDREIIIRDRNRFHHFRMGGCSCKDYW 569 >ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 624 Score = 114 bits (286), Expect = 1e-23 Identities = 47/60 (78%), Positives = 56/60 (93%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+KTKPGET+R++KNLR+C+DCH+ASKLIS+ YDREII+RDRNRFHHFR G CSC DYW Sbjct: 565 GLLKTKPGETLRISKNLRICRDCHQASKLISKVYDREIIIRDRNRFHHFRMGGCSCKDYW 624 >ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] gi|462423715|gb|EMJ27978.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] Length = 624 Score = 114 bits (285), Expect = 2e-23 Identities = 48/60 (80%), Positives = 56/60 (93%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+KTKPGET+R++KNLRVCKDCH+ASKLIS+ +DREIIVRDRNRFHHF+ G CSC DYW Sbjct: 565 GLLKTKPGETLRISKNLRVCKDCHQASKLISKVFDREIIVRDRNRFHHFKRGDCSCKDYW 624 >gb|EXB44248.1| hypothetical protein L484_001646 [Morus notabilis] Length = 633 Score = 113 bits (283), Expect = 3e-23 Identities = 48/60 (80%), Positives = 55/60 (91%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+KTKPGETIR++KNLRVCKDCH ASKL+S+ ++REIIVRDRNRFHHFR G CSC DYW Sbjct: 574 GLLKTKPGETIRISKNLRVCKDCHNASKLVSKVFEREIIVRDRNRFHHFRMGECSCQDYW 633 >gb|EPS69231.1| hypothetical protein M569_05535 [Genlisea aurea] Length = 628 Score = 110 bits (276), Expect = 2e-22 Identities = 50/61 (81%), Positives = 55/61 (90%), Gaps = 1/61 (1%) Frame = +1 Query: 1 GLIKTKPG-ETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDY 177 GL+KTK G + +RVTKNLRVC+DCHEASKLIS YDREIIVRDRNRFHHFR GVCSCND+ Sbjct: 568 GLLKTKAGGDPVRVTKNLRVCRDCHEASKLISACYDREIIVRDRNRFHHFRRGVCSCNDF 627 Query: 178 W 180 W Sbjct: 628 W 628 >ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508715014|gb|EOY06911.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 628 Score = 110 bits (276), Expect = 2e-22 Identities = 47/60 (78%), Positives = 53/60 (88%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+KTK GET R+TKNLRVC+DCH ASKLIS+ +DREIIVRDRNRFHHF+ G CSC DYW Sbjct: 569 GLLKTKTGETFRITKNLRVCRDCHHASKLISKVFDREIIVRDRNRFHHFKDGECSCKDYW 628 >ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Setaria italica] Length = 601 Score = 110 bits (274), Expect = 3e-22 Identities = 43/60 (71%), Positives = 54/60 (90%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL++T+PG+T+R+TKNLRVC+DCHEA+K +S +DREI+VRDRNRFHHFR G CSC DYW Sbjct: 542 GLLRTRPGDTMRITKNLRVCRDCHEATKFVSRVFDREIVVRDRNRFHHFRDGKCSCKDYW 601 >ref|NP_196272.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170345|sp|Q9FG16.1|PP367_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g06540 gi|10178110|dbj|BAB11403.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332003649|gb|AED91032.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 622 Score = 110 bits (274), Expect = 3e-22 Identities = 46/60 (76%), Positives = 52/60 (86%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 G++KTKPG TIR+ KNLRVC+DCH +KLISE Y RE+IVRDRNRFHHFR GVCSC DYW Sbjct: 563 GMMKTKPGTTIRIVKNLRVCEDCHTVTKLISEVYGRELIVRDRNRFHHFRNGVCSCRDYW 622 >ref|XP_004253185.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum lycopersicum] Length = 626 Score = 109 bits (273), Expect = 4e-22 Identities = 45/60 (75%), Positives = 54/60 (90%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+K+KPG+ +R+TKNLRVCKDCH+ASK IS+ Y+ EIIVRDRNRFHHF+GG CSC DYW Sbjct: 567 GLLKSKPGDILRITKNLRVCKDCHQASKFISKVYNLEIIVRDRNRFHHFKGGECSCKDYW 626 >ref|XP_007154464.1| hypothetical protein PHAVU_003G121400g [Phaseolus vulgaris] gi|561027818|gb|ESW26458.1| hypothetical protein PHAVU_003G121400g [Phaseolus vulgaris] Length = 604 Score = 109 bits (272), Expect = 5e-22 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+KTK GET+RVTKNLRVCKDCH+ASKLIS YD +II+RDRNRFHHF G CSC DYW Sbjct: 545 GLLKTKRGETLRVTKNLRVCKDCHQASKLISRVYDCDIIIRDRNRFHHFSNGECSCKDYW 604 >ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Brachypodium distachyon] Length = 599 Score = 109 bits (272), Expect = 5e-22 Identities = 42/60 (70%), Positives = 54/60 (90%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL++T+PG+T+R+TKNLRVC+DCHEA+K IS ++REI+VRDRNRFHHF+ G CSC DYW Sbjct: 540 GLLRTRPGDTVRITKNLRVCRDCHEATKFISRVFEREIVVRDRNRFHHFKDGTCSCRDYW 599 >ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Brachypodium distachyon] Length = 745 Score = 107 bits (268), Expect = 1e-21 Identities = 45/60 (75%), Positives = 55/60 (91%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+K++PG TIR++KNLRVC DCH A+KLIS+ Y+REIIVRDRNRFHHF+ G+CSCNDYW Sbjct: 686 GLMKSRPGATIRLSKNLRVCIDCHSATKLISKVYNREIIVRDRNRFHHFKDGLCSCNDYW 745 >gb|EMT27117.1| hypothetical protein F775_08942 [Aegilops tauschii] Length = 588 Score = 107 bits (267), Expect = 2e-21 Identities = 44/60 (73%), Positives = 55/60 (91%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+K++PG TIR++KNLRVC DCH A+KLIS+ Y+REI+VRDRNRFHHF+ G+CSCNDYW Sbjct: 529 GLMKSRPGATIRLSKNLRVCVDCHAATKLISKVYNREIVVRDRNRFHHFKDGLCSCNDYW 588 >ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Oryza brachyantha] Length = 598 Score = 107 bits (266), Expect = 2e-21 Identities = 41/60 (68%), Positives = 53/60 (88%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL++ +P ET+R+TKNLRVC+DCHEA+K++S +DREI+VRDRNRFHHF+ G CSC DYW Sbjct: 539 GLLRARPRETLRITKNLRVCRDCHEATKIVSRVFDREIVVRDRNRFHHFKDGTCSCKDYW 598 >ref|XP_003541335.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 607 Score = 107 bits (266), Expect = 2e-21 Identities = 45/60 (75%), Positives = 53/60 (88%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+KTK GET+RVTKNLRVCKDCH+ASK+IS+ YD +II+RDR+RFHHF G CSC DYW Sbjct: 548 GLLKTKRGETLRVTKNLRVCKDCHQASKMISKVYDCDIIIRDRSRFHHFSNGECSCKDYW 607 >ref|XP_002873264.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319101|gb|EFH49523.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 624 Score = 106 bits (265), Expect = 3e-21 Identities = 45/60 (75%), Positives = 51/60 (85%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 G++KTK G TIR+ KNLRVC+DCH A+KLISE Y RE IVRDRNRFHHFR G+CSC DYW Sbjct: 565 GMMKTKTGTTIRIVKNLRVCEDCHTATKLISEVYGREFIVRDRNRFHHFRNGLCSCRDYW 624 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 106 bits (264), Expect = 4e-21 Identities = 44/60 (73%), Positives = 53/60 (88%) Frame = +1 Query: 1 GLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVCSCNDYW 180 GL+K +PG TIR++KNLRVC DCH A+KLIS+ Y+REI+VRDRNRFHHF+ G CSCNDYW Sbjct: 636 GLMKLRPGTTIRLSKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGSCSCNDYW 695