BLASTX nr result
ID: Mentha23_contig00020923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00020923 (651 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38618.1| hypothetical protein MIMGU_mgv1a006266mg [Mimulus... 60 4e-07 ref|XP_006383127.1| hypothetical protein POPTR_0005s11820g [Popu... 50 9e-06 >gb|EYU38618.1| hypothetical protein MIMGU_mgv1a006266mg [Mimulus guttatus] Length = 450 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 490 NTDRLLSMQ*RIADMLRTLSRSADKSSCSIFKVPQSFIDINGR 362 N DRL SMQ +IAD + LSRSA +S+CSIF+VPQS IDINGR Sbjct: 23 NVDRLTSMQQKIADSPQILSRSAGRSTCSIFRVPQSLIDINGR 65 >ref|XP_006383127.1| hypothetical protein POPTR_0005s11820g [Populus trichocarpa] gi|550338706|gb|ERP60924.1| hypothetical protein POPTR_0005s11820g [Populus trichocarpa] Length = 443 Score = 50.4 bits (119), Expect(2) = 9e-06 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -3 Query: 490 NTDRLLSMQ*RIADMLRTLSRSADKSSCSIFKVPQSFIDINGRS 359 N DRL M +I+D + L+++A SSC IFKVPQ FIDING+S Sbjct: 28 NEDRLNLMHQKISDPPKLLTKAAANSSCCIFKVPQRFIDINGKS 71 Score = 25.4 bits (54), Expect(2) = 9e-06 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 555 MANDSAESNDKDSHAIRIWQV 493 M ++S E + + H IRIW+V Sbjct: 7 MESNSVEDEEGNDHVIRIWEV 27