BLASTX nr result
ID: Mentha23_contig00020860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00020860 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44651.1| hypothetical protein MIMGU_mgv1a007683mg [Mimulus... 58 1e-06 >gb|EYU44651.1| hypothetical protein MIMGU_mgv1a007683mg [Mimulus guttatus] gi|604346155|gb|EYU44652.1| hypothetical protein MIMGU_mgv1a007683mg [Mimulus guttatus] Length = 398 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +2 Query: 2 GFVTCPIIEVKDASTEAGKRERVPFGRRYPDPWKSLLYF 118 GFVTCP ++VKDAS E G+ ER+ RRY DP KSL+YF Sbjct: 340 GFVTCPTLQVKDASQETGREERITLVRRYTDPCKSLMYF 378